Display Settings:

Format

Send to:

Choose Destination
HomoloGene:1671. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002211.1              --------------------------------------------------
XP_001149577.1           --------------------------------------------------
XP_001099176.2       1   --------------------------------------MDPGSHAAHPEM   12
XP_544631.3              --------------------------------------------------
NP_001076988.1           --------------------------------------------------
NP_666237.1              --------------------------------------------------
NP_112307.2              --------------------------------------------------
NP_990212.1              --------------------------------------------------
XP_692949.1              --------------------------------------------------
XP_565625.4          1   MPICTLPTVTIYEDFDKLSAKEVYFTESGDKVTVKLLHFPNLSPEEQDHL   50
XP_002935396.2           --------------------------------------------------


NP_002211.1          1   --MTLPGGPTGMARPGGAR--PCSPGLERAPRR-SVGELRLL------FE   39
XP_001149577.1           --------------------------------------------------
XP_001099176.2      13   HGHQGPRSRATACSVDSVP--THTRILERAPRR-SVGELRLL------FE   53
XP_544631.3          1   --MTLPGGPTSMARPGGAG--PCSPGLERAPRR-SVGELRLL------FE   39
NP_001076988.1       1   --MTLPGGPTGMARPGGAG--PCSPGLERAPRR-SVGELRLL------FE   39
NP_666237.1          1   --MTLPGRPTGMARPRGAG--PCSPGLERAPRR-SVGELRLL------FE   39
NP_112307.2          1   --MTLPGHPTGMARPRGAG--PCSPGLERAPRR-SVGELRLL------FE   39
NP_990212.1          1   --MHACWYPLA---PSARR--PPGPALSRVPPS-LREWLPAD------FK   36
XP_692949.1          1   ---MPKQRRRSLREAVCSRSSPVCDGSGRGGGR-GGGGRAGN------FS   40
XP_565625.4         51   KTMSDSGDEHGAANAGTAG--HAGTSADAVPRTRKKSFTRKLSNDARKFS   98
XP_002935396.2       1   MIPTEVSSESGMNHAGGSGEPPPSPNASSVRKRLSVGELRLF------FE   44


NP_002211.1         40   ARCAAVAAAAAAGEPRARGAKRR---------------------------   62
XP_001149577.1       1   ---------------------MN---------------------------   2
XP_001099176.2      54   ARCAAVAAAAAAGEPRARGAKRR---------------------------   76
XP_544631.3         40   ARCAAVAAAAAAGQPRARGAKRR---------------------------   62
NP_001076988.1      40   ARCAAVAAAAAAGQPRARGAKRR---------------------------   62
NP_666237.1         40   ARCAAVAAAAAAGEPRARGAKRR---------------------------   62
NP_112307.2         40   ARCAAVAAAAAAGEPRARGAKRR---------------------------   62
NP_990212.1         37   NQRA--SAMKPTRKMQLPDPAKR---------------------------   57
XP_692949.1         41   STQICDDQAQMAEQYSGQAGVLS---------------------------   63
XP_565625.4         99   ALAASRKNSKDADLTALPGGANAAQSSQHAAGQHHHHHHHYHHHHHQYQY   148
XP_002935396.2      45   TRCT--AEWNGEREPRKRRMGSG---------------------------   65


NP_002211.1         63   -----GGQVPNGLPRAPP------APVIPQLTVT-AEEPDVPPTSPGPP-   99
XP_001149577.1       3   -----WGQVPNGLPRAPP------APVIPQLTVT-AEEPDVPPTSPGPP-   39
XP_001099176.2      77   -----GGQVPNGLPRAPP------ARVIPQLTVT-AEEPDVPPTSPGPP-   113
XP_544631.3         63   -----GGQVPNGLPRATP------APVIPQLTVT-AEEPDVPPASPGPP-   99
NP_001076988.1      63   -----GGQVPNGLPRAPP------APVIPQLTVT-AEEPDVPAASPGPP-   99
NP_666237.1         63   -----GGQVPNGLPRAAP------APVIPQLTVT-SEE-DVTPASPGPP-   98
NP_112307.2         63   -----GGQVPNGLPRAAP------APVIPQLTVT-SEE-DVAPASPGPP-   98
NP_990212.1         58   -----GCRPPNGV----L------PPVIPRLTVT-AEESEESQGSPKAPP   91
XP_692949.1         64   -----DSHPGRGC-------------TVPQVTIT--SDGDSREITEEDLE   93
XP_565625.4        149   QAAVPAAHSHSGPPHVQQQYQQQPVRATQRTHST--SHSQYHYQSQLPIL   196
XP_002935396.2      66   -----SWHRSNGEVVEEPRMGSWDPQAIPHLMVTSSEEPPPPPPSPSAVL   110


NP_002211.1        100   -ERERDC--LPAAGSSHLQQPRRLSTS--SVSSTGSSSLL----------   134
XP_001149577.1      40   -ERERDC--LPAAGSSHLQQPRRLSTS--SVSSTGSSSLL----------   74
XP_001099176.2     114   -ERERDC--LPAAGSSHLQQPRRLSTS--SVSSTGSSSLL----------   148
XP_544631.3        100   -EPEGGW--LPAAGSSHLQQPRRLSTS--SLSSTGSSSLP----------   134
NP_001076988.1     100   -EPEGSW--LPAVGSSHLQQPRRLSTS--SLSSTGSSSLP----------   134
NP_666237.1         99   -DQEGNW--LPAAG-SHLQQPRRLSTS--SLSSTGSSSLL----------   132
NP_112307.2         99   -DREGNW--LPAAG-SHLQQPRRLSTS--SLSSTGSSSLL----------   132
NP_990212.1         92   AHPEGGW--LRTDSSLHL-QSRRLSTS--SLSSTGSSSLL----------   126
XP_692949.1         94   EEVNGRL-------------RRKLSNS--SISSNGSSTAF----------   118
XP_565625.4        197   QHPADGAGRSECAGGGSL--RHRIGAHR-SPSPRQSASLCPGYEQYQMSL   243
XP_002935396.2     111   LELPG-WNGLKGEGLLKL-ASRRLSVSNTSLSSTGSSSAV----------   148


NP_002211.1        135   ----------EDSEDDLLSDSESRSRGNVQLEAGEDV----GQKNHWQKI   170
XP_001149577.1      75   ----------EDSEDDLLSDSESRSRGNVQLEAGEDV----GQKNHWQKI   110
XP_001099176.2     149   ----------EDSEDDLLSDSESRSRGNVQLEAGEDV----GQKSHWQKI   184
XP_544631.3        135   ----------EDSEDDLLSDSESRSRGNVQRKPGPCR----FQKSHWQKI   170
NP_001076988.1     135   ----------EDSEDDLLSDSESRSRGNVQLEAGEDV----GQKSHWQKI   170
NP_666237.1        133   ----------EDSEDDLLSDSESRSRGNVQLETSEDV----GQKSHWQKI   168
NP_112307.2        133   ----------EDSEDDLLSDSESRSRGNVQLETSEDV----GQKSHWQKI   168
NP_990212.1        127   ----------EDSEDDVLSDTECRSQGIVHLERGEDS----NQKKAWHTI   162
XP_692949.1        119   ----------DESEDDLLSDNETKSKGIVTLEHLGDSVDSAEQTNAWWKL   158
XP_565625.4        244   LEVPMPRDYGDASSDDLSSEWDSDVP-DVRHESGTKVSRGLEPPSGWRKL   292
XP_002935396.2     149   ----------EDSEDDLLSDSESKSQGHVDLEHSEEN----SLKP-WQKI   183


NP_002211.1        171   RTMVN-LPVISPFKK-RYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYC   218
XP_001149577.1     111   RTMVN-LPVISPFKK-RYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYC   158
XP_001099176.2     185   RTMVN-LPVISPFKK-RYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYC   232
XP_544631.3        171   RTMVN-LPVMSPFKK-RYAWVQLAGHTGSFKAAGTSGLILKRSSEPERYC   218
NP_001076988.1     171   RTMVN-LPVMSPFKK-RYAWVQLAGHTGSFKAAGTSGLILKRSSEPERYC   218
NP_666237.1        169   RTMVN-LPVMSPFRK-RYSWVQLAGHTGSFKAAGTSGLILKRSSEPEHYC   216
NP_112307.2        169   RTMVN-LPVMSPFKK-RYSWVQLAGHTGSFKAAGTSGLILKRSSEPEHYC   216
NP_990212.1        163   KTMVN-LPVISPFKK-RYSWVQLAGHTGSFKAAD-SGKILKRFSENEKEC   209
XP_692949.1        159   KTIVK-CPLVASQRR-RLSWVQLAGHKGSFKAGD-EGSILKKFSENENRC   205
XP_565625.4        293   RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTVLKKLCPKEEKC   342
XP_002935396.2     184   RTMVN-IPVFSPFKR-R--WVQLAGHTGSFKAAA-NGTILKRYSENEKNA   228


NP_002211.1        219   LARLMADALRGCVPAFHGVVER-DGES-YLQLQDLLDGFDGPCVLDCKMG   266
XP_001149577.1     159   LARLMADALRGCVPAFHGVVER-DGES-YLQLQDLLDGFDGPCVLDCKMG   206
XP_001099176.2     233   LARLMADALRGCVPAFHGVVEH-DGES-YLQLQDLLDGFDGPCVLDCKMS   280
XP_544631.3        219   LARLMADALRGCVPAFHGEVER-DGES-YLQLQDLLDGFDGPCVLDCKMG   266
NP_001076988.1     219   LARLMADALRGCVPAFHGVVER-DGES-YLQLQDLLDGFDGPCVLDCKMG   266
NP_666237.1        217   LVRLMADVLRGCVPAFHGIVER-DGES-YLQLQDLLDGFDGPCVLDCKMG   264
NP_112307.2        217   LVRLMADVLRGCVPAFHGVVER-DGES-YLQLQDLLDGFDGPCVLDCKMG   264
NP_990212.1        210   FERLMKDPLRSCVPCFHGVVER-DGET-YIQLDDLLTDFEGPCVMDCKMG   257
XP_692949.1        206   FERLKEDALHGFVPGYYGLVKR-DGEL-FLKMTDLLASFDTPNVMDCKMG   253
XP_565625.4        343   FKVLMKDVLRPYVPEYKGQVNSEDGESTYIQLQDLLSDFYQPCVMDCKIG   392
XP_002935396.2     229   FELVMKDSLVHCVPAYHGVVER-DGES-YIQLDDLLNSFDEPCVMDCKMG   276


NP_002211.1        267   VRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYM   316
XP_001149577.1     207   VRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYM   256
XP_001099176.2     281   VRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYM   330
XP_544631.3        267   VRTYLEEELTKARERPKLRKDMYKKMLAVDPAAPTEEEHAQRAVTKPRYM   316
NP_001076988.1     267   VRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYM   316
NP_666237.1        265   VRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYM   314
NP_112307.2        265   VRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYM   314
NP_990212.1        258   IRTYLEEELTKAREKPKLRKDMYKKMIEVDPLAPTAEENAQHAVTKPRYM   307
XP_692949.1        254   VRTYLEDELVRARVKPKLREDLYNKMLEVDSGAPTAEERQQKAVTKPRYM   303
XP_565625.4        393   VRTYLEEELSKAKEKPKLRKDMYEKMIQIDQNAPTEEEHRAKGVTKPRYM   442
XP_002935396.2     277   IRTYLEEELTKARGKPKLRKDMYKKMIEVNPLAPTEEENAQQAVTKPRYM   326


NP_002211.1        317   QWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFEEFVQGD   366
XP_001149577.1     257   QWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFEEFVQGD   306
XP_001099176.2     331   QWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFEEFVQGD   380
XP_544631.3        317   QWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVIRVFEEFVQGD   366
NP_001076988.1     317   QWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVIRVFEEFVQGD   366
NP_666237.1        315   QWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVTRVFEEFMQGD   364
NP_112307.2        315   QWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVTRVFEEFMQGD   364
NP_990212.1        308   QWRETISSSANLGFRIEGIKKADGTCNTNFKTTKTQEQVLQVFVEFIEGN   357
XP_692949.1        304   QWRESLSSTHTLGFRIEGIKRGE-TCNTDFKKTRSKEDVTQVFKDFIEGN   352
XP_565625.4        443   VWRETISSTSTLGFRIEGIKKSDGTSSKDFKTTKSRDQICEAFREFTDGF   492
XP_002935396.2     327   QWRETISSTSTLGFRIEGIKKGDGTCNTNFKTTKTRDQIDQAFLQFIDGD   376


NP_002211.1        367   EEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLID   416
XP_001149577.1     307   EEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLID   356
XP_001099176.2     381   EEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLID   430
XP_544631.3        367   AEVLRRYLNRLLQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLID   416
NP_001076988.1     367   AEVLRRYLNRLQHIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLID   416
NP_666237.1        365   AEVLRRYLNRLQQIRDTLEISDFFRRHEVIGSSLLFVHDHCHRAGVWLID   414
NP_112307.2        365   AEVLKRYLNRLQQIRDTLEISDFFRRHEVIGSSLLFVHDHCHRAGVWLID   414
NP_990212.1        358   TTILKKYLKRLQEIHIILESSDFFKRHEVVGSSLLFVHDGSGNANVWLID   407
XP_692949.1        353   KNIINSYITRLEEIKRALKASEFFKKHEVIGSSLLFIHDHTERAEVWLID   402
XP_565625.4        493   PHAMPKYIQRLKAIRATLEYSEFFKSHEVIGSSLLFVHDR-HKASVWLID   541
XP_002935396.2     377   KDILNKYICRLQEIRTIVESSEFFKKHEVIGSSLLFVHDKKGKANVWLID   426


NP_002211.1        417   FGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER-----   461
XP_001149577.1     357   FGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER-----   401
XP_001099176.2     431   FGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER-----   475
XP_544631.3        417   FGKTTPLPDGQTLDHRRPWEEGNREDGYLLGLDNLISILASLAER-----   461
NP_001076988.1     417   FGKTTPLPDGQTLDHRRPWEEGNREDGYLLGLDNLIGILASLAER-----   461
NP_666237.1        415   FGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER-----   459
NP_112307.2        415   FGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILANLAER-----   459
NP_990212.1        408   FGKTTLLPDGQTLDHRIPWQEGNREDGYLLGLDNLIRILESITER-----   452
XP_692949.1        403   FGKTTALPDGQYLDHYRPWEEGNREDGYLWGLDNLLQTLSSLGKRE----   448
XP_565625.4        542   FAKTVALPESVAITHDSKWKVGNHEDGYLIGINNLIDIFSEVHDRQTLQC   591
XP_002935396.2     427   FGKTTQLPEGQVLDHRIPWQEGNREDGYLYGFDNLIDILSSIAC------   470


NP_002211.1              --------------------------------------------------
XP_001149577.1           --------------------------------------------------
XP_001099176.2           --------------------------------------------------
XP_544631.3              --------------------------------------------------
NP_001076988.1           --------------------------------------------------
NP_666237.1              --------------------------------------------------
NP_112307.2              --------------------------------------------------
NP_990212.1              --------------------------------------------------
XP_692949.1              --------------------------------------------------
XP_565625.4        592   LTERIPRLSLPDDTNGIDANSDDPLRHDGCNRNSEISSAAVPAVPDRCVD   641
XP_002935396.2           --------------------------------------------------


NP_002211.1              -----------------------------------------
XP_001149577.1           -----------------------------------------
XP_001099176.2           -----------------------------------------
XP_544631.3              -----------------------------------------
NP_001076988.1           -----------------------------------------
NP_666237.1              -----------------------------------------
NP_112307.2              -----------------------------------------
NP_990212.1              -----------------------------------------
XP_692949.1              -----------------------------------------
XP_565625.4        642   KIGCVNNNNNYDCKPEDQQLVGNSTADTSTGLRDCIGSSSG   682
XP_002935396.2           -----------------------------------------


Protein Acc. Gene Organism
NP_002211.1 ITPKA H.sapiens
XP_001149577.1 ITPKA P.troglodytes
XP_001099176.2 ITPKA M.mulatta
XP_544631.3 ITPKA C.lupus
NP_001076988.1 ITPKA B.taurus
NP_666237.1 Itpka M.musculus
NP_112307.2 Itpka R.norvegicus
NP_990212.1 ITPKA G.gallus
XP_692949.1 LOC564528 D.rerio
XP_565625.4 AgaP_AGAP002194 A.gambiae
XP_002935396.2 LOC100486229 X.tropicalis


Support Center