Display Settings:

Format

Send to:

Choose Destination
HomoloGene:1609. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001091742.1       1   --------------------------------MPGSLPLNAEACWPKDVG   18
XP_003310783.1       1   --------------------------------MPGSLPLNAEACWPKDVG   18
XP_002804403.1       1   --------------------------------MPGSLPLNAEACWPKDVG   18
XP_005619400.1       1   --------------------------------MPGSLPLNAEACWPKDVG   18
NP_001193507.1       1   --------------------------------MPGSLPLNAEACWPKDVG   18
NP_666054.2          1   --------------------------------MPGSLPLNAEACWPKDVG   18
NP_058964.1          1   --------------------------------MPGSLPLNAEACWPKDVG   18
NP_990742.1          1   --------------------------------MPGSLPVNTESCWPKDVG   18
NP_957379.1          1   -------------------------------------------MWPKDVG   7
NP_725570.1          1   ----------------------------------------MASHWPENVG   10
XP_315872.3          1   ---------------------------------MSSSNSTTSGQWPEDVG   17
NP_013580.1          1   MKLSTKLCWCGIKGRLRPQKQQQLHNTNLQMTELKKQKTAEQKTRPQNVG   50
XP_453529.2          1   ------------------MTEQDLA---------KKQKTVDQPPRPQNVG   23
NP_983739.1          1   ------------------MTDPNQA---------KKQKIEAQPPRPQNIG   23
NP_593859.1          1   -----------------------------------------MSFDRKDIG   9
XP_003717917.1       1   -----------------------------------------MASRPQNIG   9
XP_957561.1          1   -----------------------------------------MATRPQNIG   9
NP_192919.1          1   --------------------------------------------MAKNVG   6
NP_001048774.1       1   -----------------------------------------MAAERKDVG   9
NP_001062410.1       1   ------------------------------------------MEQPNDVG   8
NP_001063706.1       1   ------------------------------------------MDGRKDVG   8
NP_001120172.1       1   --------------------------------MPGSLPPNGESSWPKDVG   18


NP_001091742.1      19   IVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSL   68
XP_003310783.1      19   IVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSL   68
XP_002804403.1      19   IVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSL   68
XP_005619400.1      19   IVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSL   68
NP_001193507.1      19   IVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSL   68
NP_666054.2         19   IVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCTDREDINSL   68
NP_058964.1         19   IVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCTDREDINSL   68
NP_990742.1         19   IVALEIYFPSQYVDQTELEKYDGVDAGKYTIGLGQSKMGFCSDREDINSL   68
NP_957379.1          8   IIAMEVYVPSQYVDQAELEEYDGVGAGKYTVGLGQARMGFCSDREDINSL   57
NP_725570.1         11   IRAIEILFPSQYVDQTELETFDGASAGKYTIGLGQAKMGFCSDREDVNSL   60
XP_315872.3         18   ILGLEIVFPSQYVDQTELEAFDGVSAGKYTIGLGQQRMGFCSDREDINSL   67
NP_013580.1         51   IKGIQIYIPTQCVNQSELEKFDGVSQGKYTIGLGQTNMSFVNDREDIYSM   100
XP_453529.2         24   IKGIEIYIPSQCVNQEELEKFDGVSSGKYTIGLGQTNMGFVNDREDIYSM   73
NP_983739.1         24   IKAIELYIPSQCVNQEALEAYDGVSQGKYTIGLGQTNMSFVNDREDIYSM   73
NP_593859.1         10   IKGLVLYTPNQYVEQAALEAHDGVSTGKYTIGLGLTKMAFVDDREDIYSF   59
XP_003717917.1      10   IKAIEIYFPSQYVEQSELEKFDGVSSGKYTIGLGQTKMAFCDDREDIYSL   59
XP_957561.1         10   IKAIEIYFPSQYVEQSELEKFDGVSTGKYTIGLGQTKMAFCDDREDIYSL   59
NP_192919.1          7   ILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISM   56
NP_001048774.1      10   ILAMDIYFPPTCVLQDELENHDGVSKGKYTIGLGQDSMAFCTEVEDVISM   59
NP_001062410.1       9   ILAMDIYFPPACVHQEALEAHDGASKGKYTIGLGQDCMAYCSEVEDVISM   58
NP_001063706.1       9   ILAMDIYFPPTCVLQESLEAHDGASKGKYTIGLGQDCMAFCSEVEDVISM   58
NP_001120172.1      19   IVALEIYFPSQYVDQVELEKFDGVSAGKYTIGLGQCKMGFCSDREDINSL   68


NP_001091742.1      69   CMTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNT   118
XP_003310783.1      69   CMTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNT   118
XP_002804403.1      69   CMTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNT   118
XP_005619400.1      69   CLTVVQNLMERHSLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNT   118
NP_001193507.1      69   CMTVVQNLMERNSLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNT   118
NP_666054.2         69   CLTVVQKLMERHSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNT   118
NP_058964.1         69   CLTVVQKLMERNSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNT   118
NP_990742.1         69   CLTVVQKLMERNSLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNT   118
NP_957379.1         58   CLTVVQRLMERNGLSYESVGRLEVGTETIIDKSKSTKTVLMQLFEESGNT   107
NP_725570.1         61   CLTVVSRLLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNT   110
XP_315872.3         68   CLTAARNLLERHSIPLDRIGRLEVGTETIVDKSKSVKSVLMQLFEPEGVT   117
NP_013580.1        101   SLTVLSKLIKSYNIDTNKIGRLEVGTETLIDKSKSVKSVLMQLFGE--NT   148
XP_453529.2         74   SLTVLSKLLKNYNIDTNNVGRIEVGTETLLDKSKSVKSVLTQLFPG--NS   121
NP_983739.1         74   CLTACSNLMKNYDIKPESIGRLEVGTETLLDKSKSVKSILMQLFGE--NT   121
NP_593859.1         60   GLTALSQLIKRYQIDISKIGRLEVGTETIIDKSKSVKSVLMQLFGD--NH   107
XP_003717917.1      60   ALTATSNLLKKYAIDTNSVGRLEVGTETLLDKSKSVKSVLMQLFGD--NT   107
XP_957561.1         60   ALTAVSRLLKNYEIDTNTIGRLEVGTETLLDKSKSVKSVLMQLFGE--NT   107
NP_192919.1         57   SFNAVTSLFEKYKIDPNQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNT   106
NP_001048774.1      60   SLTVVKSLLENYKIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEECGNT   109
NP_001062410.1      59   SLTVVASLLKKYNIDPKQIGRLEVGSETVIDKSKSIKTWLMHIFEESGNT   108
NP_001063706.1      59   SMTVVTSLLKKYKVDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEECGNT   108
NP_001120172.1      69   CLTVVQRLMERNNLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNT   118


NP_001091742.1     119   DIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNA   168
XP_003310783.1     119   DIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNA   168
XP_002804403.1     119   DIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNA   168
XP_005619400.1     119   DIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNA   168
NP_001193507.1     119   DIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNA   168
NP_666054.2        119   DIEGIDTTNACYGGTAAVFNAVNWVESSSWDGRYALVVAGDIAIYATGNA   168
NP_058964.1        119   DIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAIYASGNA   168
NP_990742.1        119   DVEGIDTTNACYGGTAALFNAINWIESSSWDGRYALVVAGDIAVYATGNA   168
NP_957379.1        108   DVEGVDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSA   157
NP_725570.1        111   DIEGIDTTNACYGGTAALFNAVNWVESSSWDGRLALAVCADIAVYAKGAA   160
XP_315872.3        118   DLEGIDTTNACYGGTAALLNAINWIESSSWDGRLALVVCGDIAVYAQGSA   167
NP_013580.1        149   DVEGIDTLNACYGGTNALFNSLNWIESNAWDGRDAIVVCGDIAIYDKGAA   198
XP_453529.2        122   DTEGIDTLNACYGGTNALFNSLNWIESSAWDGRDAIVVCGDIAIYEKGAA   171
NP_983739.1        122   DLEGVDTVNACYGGTNALFNSLNWIESSSWDGRDAIVVCGDIAIYDKGAA   171
NP_593859.1        108   NVEGIDCVNACYGGVNALFNTIDWIESSAWDGRDGIVVAGDIALYAKGNA   157
XP_003717917.1     108   NIEGVDTVNACYGGTNALINSVNWIEGSGWDGRDAIVVAGDIALYAKGNA   157
XP_957561.1        108   NIEGVDTINACYGGTNAFFNSVNWIESSAWDGRDAIVVAGDIALYAKGNA   157
NP_192919.1        107   DVEGVDSTNACYGGTAALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPA   156
NP_001048774.1     110   DIEGVDSSNACYGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPA   159
NP_001062410.1     109   DIEGVDSSNACYGGTAALLNCVNWVESKSWDGRYGLVVCTDSAVYAEGPA   158
NP_001063706.1     109   DIEGVDSSNACYGGTAALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPA   158
NP_001120172.1     119   DVEGIDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSA   168


NP_001091742.1     169   RPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDG   218
XP_003310783.1     169   RPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDG   218
XP_002804403.1     169   RPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDG   218
XP_005619400.1     169   RPTGGVGAVALLIGPNAPLIFDRGLRGTHMQHAYDFYKPDMLSEYPIVDG   218
NP_001193507.1     169   RPTGGVGAVAMLIGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDG   218
NP_666054.2        169   RPTGGVGAVALLIGPNAPLIFDRGLRGTHMQHAYDFYKPDMLSEYPVVDG   218
NP_058964.1        169   RPTGGVGAVALLIGPNAPVIFDRGLRGTHMQHAYDFYKPDMLSEYPVVDG   218
NP_990742.1        169   RPTGGAGAVAMLVGSNAPLIFERGLRGTHMQHAYDFYKPDMVSEYPVVDG   218
NP_957379.1        158   RPTGGAGAVAMLVGPNAPLAFERGLRGTHMQHAYDFYKPDMVSEYPVVDG   207
NP_725570.1        161   RPTGGAGAVAMLVGPNAPLILDRGLRATHMEHAYDFYKPDLSSEYPTVDG   210
XP_315872.3        168   RPTGGAGAVAMLIGPNAPLRFERGLRATYMKHAYDFYKPDLSSEYPVVDG   217
NP_013580.1        199   RPTGGAGTVAMWIGPDAPIVFDS-VRASYMEHAYDFYKPDFTSEYPYVDG   247
XP_453529.2        172   RPTGGAGTVALWIGPDAPIVFDP-IRGSFMEHAYDFYKPDFTSEYPYVDG   220
NP_983739.1        172   RPTGGAGTVALLIGPDAPIVFDS-VRGSYMEHVYDFYKPDFRSEYPYVDG   220
NP_593859.1        158   RPTGGAGCVALLVGPNAPIVFEPGLRGTYMQHAYDFYKPDLTSEYPYVDG   207
XP_003717917.1     158   RPTGGAGCVAMLVGPDAPIVVEPGLRGSFMQHAYDFYKPDLASEYPYVDG   207
XP_957561.1        158   RPTGGAGCVAMLVGPNAPIAVEPGLRGSYMAHAYDFYKPDLTSEYPYVDG   207
NP_192919.1        157   RPTGGAAAIAMLIGPDAPIVFESKLRASHMAHVYDFYKPNLASEYPVVDG   206
NP_001048774.1     160   RPTGGAAAIAMLIGPNAPVSFESKYRGSHMAHVYDFYKPDLASEYPVVDG   209
NP_001062410.1     159   RPTGGAAAIAMLIGPNAPISFESKYRASHMAHVYDFYKPDLASEYPVVDG   208
NP_001063706.1     159   RPTGGAAAIAMLIGPNAPIAFESKYKASHMAHVYDFYKPDLASEYPVVDG   208
NP_001120172.1     169   RPTGGAGAVAMLVGPNATLVFERGLRGTHMQHAYDFYKPDMESEYPVVDG   218


NP_001091742.1     219   KLSIQCYLSALDRCYSVYCKK--IHAQWQKEGNDKDFT----LNDFGFMI   262
XP_003310783.1     219   KLSIQCYLSALDRCYSVYCKK--IRAQWQKEGNDKDFT----LNDFGFMI   262
XP_002804403.1     219   KLSIQCYLSALDRCYSVYCKK--IRAQWQKEGNDKDFT----LNDFGFMI   262
XP_005619400.1     219   KLSIQCYLSALDRCYSVYRKK--IRAQWQKEGNDKDFT----LNDFGFMI   262
NP_001193507.1     219   KLSIQCYLSALDRCYSVYRKK--IRARWQKEGNDRDFT----LNDFGFMI   262
NP_666054.2        219   KLSIQCYLSALDRCYSVYRKK--IRAQWQKEGKDKDFT----LNDFGFMI   262
NP_058964.1        219   KLSIQCYLSALDRCYSVYRKK--IRAQWQKEGKDKDFT----LNDFGFMI   262
NP_990742.1        219   KLSIQCYLSALDRCYSVYRNK--IHAQWQKEGTDRGFT----LNDFGFMI   262
NP_957379.1        208   KLSIQCYLSALDQCYSVYKNK--IHARWQREGTEGRCS----LEDFGFMV   251
NP_725570.1        211   KLSIQCYLSALDTCYRLYRKK--FDQQ-QKDTSKQPAS----LSTFDAIL   253
XP_315872.3        218   KLSIQCYLSALDACYQLYRKK--FAQR-HPDLV-APVT----LDTFDAVI   259
NP_013580.1        248   HFSLTCYVKALDQVYKSYSKK--AISKGLVSDPAGSDALNV-LKYFDYNV   294
XP_453529.2        221   HFSLTCYVKALDKAYEAYSKK--AIAKGLAAKPAGNSAINV-TEHFDYNV   267
NP_983739.1        221   HFSLTCYVKAVDQAYRAYSRK--AIAKGLAENPAGPEAVNV-ATFFDYNV   267
NP_593859.1        208   HFSLECYVKALDGAYANYNVRD-VAKNGKSQGLG--------LDRFDYCI   248
XP_003717917.1     208   HFSLTCYTKALDGAYRAYNKREAQLQNGHANGNGAADSSKTPLDRFDYIA   257
XP_957561.1        208   HYSVNCYTEALDGAYRAYNQREKLLTNG-VNGH-SEDSTKTPLDRFDYLA   255
NP_192919.1        207   KLSQTCYLMALDSCYKHLCNK-------FEKIEGKEFS----INDADYIV   245
NP_001048774.1     210   KLSQTCYLMALDSCYNVFCKK-------YEKLEGKQFS----IHDADYFV   248
NP_001062410.1     209   KLSQTCYLMALDSCYRQYCTK-------YEKIVGEQFS----ISDAEYCV   247
NP_001063706.1     209   KLSQTCYLMALDSCYRQFCKK-------YEKLAGKQFS----ISDADYFV   247
NP_001120172.1     219   KLSIQCYLSALDHCYTTYRKK--IHAQWQKEGTDKPFT----LNDFGFMI   262


NP_001091742.1     263   FHSPYCKLVQKSLARMLLNDFLNDQNRDK-NSIYSGLEA-FGDVKLEDTY   310
XP_003310783.1     263   FHSPYCKLVQKSLARMLLNDFLNDQNRDK-NSIYSGLEA-FGDVKLEDTY   310
XP_002804403.1     263   FHSPYCKLVQKSLARMLLNDFLNDQNRDK-NSIYSGLEA-FGDVKLEDTY   310
XP_005619400.1     263   FHSPYCKLVQKSLARMLLNDFLNDQNRDK-NSIYSGLEA-FGDVKLEDTY   310
NP_001193507.1     263   FHSPYCKLVQKSLARMLLNDFLNDQNRDK-NSIYSGLEA-FGDVKLEDTY   310
NP_666054.2        263   FHSPYCKLVQKSLARMFLNDFLNDQNRDK-NSIYSGLEA-FGDVKLEDTY   310
NP_058964.1        263   FHSPYCKLVQKSLARMFLNDFLNDQNRDK-NSIYSGLEA-FGDVKLEDTY   310
NP_990742.1        263   FHSPYCKLVQKSVARLLLNDFLSDQNAETANGVFSGLEA-FRDVKLEDTY   311
NP_957379.1        252   FHSPYCKLVQKSLARLMLNDFLCHPSPNMESGPFSGLEA-FRDVKIEDTY   300
NP_725570.1        254   FHTPFCKLVQKSVGRLSFNDFLLSSEEER-TKQFPDLER-FNTATLESTY   301
XP_315872.3        260   FHSPYCKLVQKSLARIGLNDFVLTPADQR-PALFPGFEQ-FANVRLEDTY   307
NP_013580.1        295   FHVPTCKLVTKSYGRLLYNDFRANPQ------LFPEVDAELATRDYDESL   338
XP_453529.2        268   FHVPTCKLVTKSYGRLLYNDFRANPS------LYPEIDASLASVEYETSL   311
NP_983739.1        268   FHVPTCKLVTKSYGRLLYNDFRANPE------LYPEVSADLATLDYEASL   311
NP_593859.1        249   FHAPTCKQVQKAYARLLYTDSAAEPS----NPELEGVRELLSTLDAKKSL   294
XP_003717917.1     258   FHSPTCKLVQKSYARLLYHDYLANPD----HPAFAEVPGELRDMDYEKSL   303
XP_957561.1        256   FHAPTCKLVQKSYARLLYHDYLANPE----SPVFADVPPEVRDMDYKKSL   301
NP_192919.1        246   FHSPYNKLVQKSFARLLYNDFLRNASSID-EAAKEKFTP-YSSLTLDESY   293
NP_001048774.1     249   FHSPYNKLVQKSFARLYYNDFLRKCSTVE-DGSREKLEP-YSGLSSEESY   296
NP_001062410.1     248   FHSPYNKLVQKSFARLYFNDFMRNCSTVD-NDAKEKLQP-FANLTSEESY   295
NP_001063706.1     248   FHSPYNKLVQKSFARLYYNDFTRDCSSVD-NDAKEKLQP-FSNLTGEESY   295
NP_001120172.1     263   FHSPYCKLVQKSLARLLVNDFISDSDPDMESGMYVGLDS-FRDLKLEETY   311


NP_001091742.1     311   FDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY   360
XP_003310783.1     311   FDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY   360
XP_002804403.1     311   FDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY   360
XP_005619400.1     311   FDRDVEKAFMKASAELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY   360
NP_001193507.1     311   FDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY   360
NP_666054.2        311   FDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY   360
NP_058964.1        311   FDRDVEKAFMKASAELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY   360
NP_990742.1        312   FDRDVEKAFMKASAELFNQKTKASLLVSNQNGNMYTPSVYGCLASLLAQY   361
NP_957379.1        301   FDRDVEKAFMKASSELFDDKTKASLLISNQNGNMYTPSVYGCLASVLAQH   350
NP_725570.1        302   FDRDVEKAFMTQSANIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISG   351
XP_315872.3        308   FDRDVEKAFMAQYAPVFAAKTKRSLHLASQVGNMYTPSVYSCLVSLLVGS   357
NP_013580.1        339   TDKNIEKTFVNVAKPFHKERVAQSLIVPTNTGNMYTASVYAAFASLLNYV   388
XP_453529.2        312   TDKNLEKTFVNVAKPFHKERVAPSLIVPTNTGNMYTASVYASLSSLLCYV   361
NP_983739.1        312   ADKNIEKTFVGLAKPLHKARVEPSLVVPTNTGNMYTGSVYAALASLLYYV   361
NP_593859.1        295   TDKALEKGLMAITKERFNKRVSPSVYAPTNCGNMYTASIFSCLTALLSRV   344
XP_003717917.1     304   TDKGVEKAFMALTKKRFQERVNPGIQVATLCGNMYCASVWGGLSSLIGHV   353
XP_957561.1        302   TDKVVEKTFMTLTKKRFQERVNPAIQVPTLCGNMYCGSVWGGLASIIGHV   351
NP_192919.1        294   QSRDLEKVSQQIAKPFYDAKVQPTTLIPKEVGNMYTASLYAAFASLI-HK   342
NP_001048774.1     297   QSRELEKASQQVAKHLYDSKVQPITLIPKQVGNMYTASLYAALASVM-HN   345
NP_001062410.1     296   QSRDLEKASQQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVI-YN   344
NP_001063706.1     296   QSRDLEKASQQVAKPLYDIKVQPSTLLPKQIGNMYTASLYAALASVL-YN   344
NP_001120172.1     312   FDRDVEKAFLKASTELFNDKTKASLLVSRENGNMYTPSVYGCLASVLAQY   361


NP_001091742.1     361   SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKS   410
XP_003310783.1     361   SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKS   410
XP_002804403.1     361   SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKS   410
XP_005619400.1     361   SPQQLAGKRIGVFSYGSGLAATLYSLRVTQDATPGSALDKITASLCDLKS   410
NP_001193507.1     361   SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKIVASICDLKS   410
NP_666054.2        361   SPQQLAGKRVGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKS   410
NP_058964.1        361   SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKS   410
NP_990742.1        362   SPEHLAGQRISEFSYGSGFAATLYSIRVTQDATPGSALDKITASLSDLKA   411
NP_957379.1        351   TPQQLAGQRIGVFSYGSGFAATLYSIKVTQDATPGSALDKLVSSLCDLPA   400
NP_725570.1        352   PAQELVGKRIGLFSYGSGLAASMYSISVTQDA---AAFEKFVSQLDYVQP   398
XP_315872.3        358   DVDELLGKRVGVFSYGSGLASSMYSIAVTTDR---ERLAEFKRHLNYVQP   404
NP_013580.1        389   GSDDLQGKRVGLFSYGSGLAASLYSCKIVGDV-------QHIIKELDITN   431
XP_453529.2        362   GSDALQNKRIGLFSYGSGLAASLFSCKVVGDI-------KHIVDVLDVEN   404
NP_983739.1        362   GNDALQGKRIGLFSYGSGLAASLFSVRVLGDI-------KHITHNLALDT   404
NP_593859.1        345   PADELKGKRVGAYSYGSGLAASFFSFVVKGDV-------SEIAKKTNLVN   387
XP_003717917.1     354   DSATLQGKRIGLFSYGSGLAASFLSFRVNGST-------ETISKALDIPN   396
XP_957561.1        352   DSAQLEGKRIGLFSYGSGLAASFCSFRVTGST-------EKLAKTLNLPA   394
NP_192919.1        343   KHNDLAGKRVVMFSYGSGSTATMFSLRLNDNKPPFSI--SNIASVMDVGG   390
NP_001048774.1     346   KNETLAGQRIVMFSYGSGLTSTMFSFKINEGQHPFIL--SNIAGILDVSK   393
NP_001062410.1     345   KHDSLDGQRILMFSYGSGLTSTMFSLRLHDGQHPFSL--MNIASVLDVTT   392
NP_001063706.1     345   KHASLDDQRIVMFSYGSGLTSTMFSLKLNNGQDPFSL--SNIASVLNATE   392
NP_001120172.1     362   SPQQLAGQRIGVFSYGSGFAATMYSLRVSQDAMPGSSLDKLTSSLSDLKA   411


NP_001091742.1     411   RLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGS--IDSLFEGTWYLVRV   458
XP_003310783.1     411   RLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGS--IDSLFEGTWYLVRV   458
XP_002804403.1     411   RLDSRTCVAPDVFAENMKLREDTHHLVNYIPQGS--IDSLFEGTWYLVRV   458
XP_005619400.1     411   RLDSRTCVAPDVFAENMKLREDTHHLVNYIPQSS--VDSLFEGTWYLVRV   458
NP_001193507.1     411   RLDSRTCVAPDIFAENMKLREDTHHLANYIPQSS--IDSLFEGTWYLVRV   458
NP_666054.2        411   RLDSRTCVAPDVFAENMKLREDTHHLANYIPQCS--IDSLFEGTWYLVRV   458
NP_058964.1        411   RLDSRTCVAPDVFAENMKLREDTHHLANYIPQCS--IDSLFEGTWYLVRV   458
NP_990742.1        412   RLDSRKCIAPDVFAENMKIRQETHHLANYIPQCS--VEDLFEGTWYLVRV   459
NP_957379.1        401   RLDSRQKVSPGVFAETMKLREETHHLANYIPQGS--VDELFPGTWYLTRV   448
NP_725570.1        399   LLNSREKVAPEQFSALMEVREKNNHAAPYTPTGS--ISALFPGTYYLKDV   446
XP_315872.3        405   LLDRRTKVEPAEFTRLMEVREKNNHAAPYEPSGS--VEVLFPGTYYLKAV   452
NP_013580.1        432   KLAKRITETPKDYEAAIELRENAHLKKNFKPQGS--IEHLQSGVYYLTNI   479
XP_453529.2        405   KLKSRKTESPEDYEKAILLREQAHLQKSFEPTGS--IENLYPGTYYLTNV   452
NP_983739.1        405   KLQNRKTETPEDYEKALALREAAHLQKAYTPQGS--LDLLQPGTYYLTAV   452
NP_593859.1        388   DLDNRHCLTPTQYEEAIELRHQAHLKKNFTPKGS--IERLRSGTYYLTGI   435
XP_003717917.1     397   RLEARRAVQPQTYDDMCEMRKKAHLQKNFTPTGD--VSTIVNGTYYLENV   444
XP_957561.1        395   RLAARRAVPPESYDAMCDLRKQAHLQKNYTPKGE--VSTLEPGTYYLENV   442
NP_192919.1        391   KLKARHEYAPEKFVETMKLMEHRYGAKDFVTTKEGIIDLLAPGTYYLKEV   440
NP_001048774.1     394   KLESRHVVAPEKFVAALKLMEHRYGAKDFTTSQD--TSLLAPGTYYLTHV   441
NP_001062410.1     393   KLESRHVTSPEKFIETLKLMEHRYGAKDFETSKD--TSLLPPGTFYLTKV   440
NP_001063706.1     393   KLESRHMTLPEKFVETLKLMEHRYGAKDFETCKD--TSLLPPGTFYLTRV   440
NP_001120172.1     412   RLDSRKNVSPSNFADTMKLRQDTHHLANYIPQGS--VDDLFPGTWYLVRV   459


NP_001091742.1     459   DEKHRRTYARRPTPNDDTLDEGVGLVHSNIATEHIPSPAKKVPRLPATA-   507
XP_003310783.1     459   DEKHRRTYARRPTPNDDTLDEGVGLVHSNIATEHIPSPAKKVPRLPATA-   507
XP_002804403.1     459   DEKHRRTYARRPTPNDDTLDEGVGLVHSNTATEHIPSPAKKVPRLPATA-   507
XP_005619400.1     459   DEKHRRTYARRPSPSEDTLGEGVGLVHSSAATEHIPSPAKKVPRLPATA-   507
NP_001193507.1     459   DEKHRRTYARRPSLNDDTLNEGVGLVHPSTTAEHIPSPAKKVPRLPATA-   507
NP_666054.2        459   DEKHRRTYARRPFTNDHSLDEGMGLVHSNTATEHIPSPAKKVPRLPATS-   507
NP_058964.1        459   DEKHRRTYARRPSTNDHSLDEGVGLVHSNTATEHIPSPAKKVPRLPATS-   507
NP_990742.1        460   DEKHRRTYARRPVMGDGPLEAGVEVVHPGIVHEHIPSPAKKVPRIPATTE   509
NP_957379.1        449   DEKHRRQYARRSMNDDRPLEAG--LVSSSMAAEHIPSPLKKMPRIPTTT-   495
NP_725570.1        447   DALHRRTYERTPT-------------------------------------   459
XP_315872.3        453   DSMHRRTYERVPP-------------------------------------   465
NP_013580.1        480   DDKFRRSYDVKK--------------------------------------   491
XP_453529.2        453   DDRYRRSYAIKE--------------------------------------   464
NP_983739.1        453   DDRYRRSYAVKE--------------------------------------   464
NP_593859.1        436   DDMFRRSYSVKP--------------------------------------   447
XP_003717917.1     445   DDMFKRTYSVKA--------------------------------------   456
XP_957561.1        443   DDMFKRTYSIKA--------------------------------------   454
NP_192919.1        441   DSLYRRFYGKKG---------------------------ED---------   454
NP_001048774.1     442   DSMYRRFYAVKG---------------------------Q----------   454
NP_001062410.1     441   DSMYRRFYDKKA---------------------------AE----GKIK-   458
NP_001063706.1     441   DSMYRRFYERKA---------------------------DEEIAAAKAKY   463
NP_001120172.1     460   DEKHRRFYARSSLMNDGPLDAAPESVHASTANEHFPSPAKKVPRIPPA--   507


NP_001091742.1     508   AEPEAAVISNGEH   520
XP_003310783.1     508   AEPEAAVISNGEH   520
XP_002804403.1     508   AEPEAAVISNGEH   520
XP_005619400.1     508   AEAEAAVISNGEH   520
NP_001193507.1     508   AEPEAAVISNGEH   520
NP_666054.2        508   AESESAVISNGEH   520
NP_058964.1        508   GEPESAVISNGEH   520
NP_990742.1        510   SEGVTVAISNGVH   522
NP_957379.1        496   AGPEVVVMSNGDH   508
NP_725570.1        460   -------ISNGVH   465
XP_315872.3        466   -------EQPSS-   470
NP_013580.1              -------------
XP_453529.2              -------------
NP_983739.1              -------------
NP_593859.1              -------------
XP_003717917.1           -------------
XP_957561.1              -------------
NP_192919.1        455   ------GSVANGH   461
NP_001048774.1     455   ----AVTEVSNGH   463
NP_001062410.1     459   ----GCNGIANGH   467
NP_001063706.1     464   SNGHATNGYANGH   476
NP_001120172.1     508   AEAVPISVTNGEH   520


Protein Acc. Gene Organism
NP_001091742.1 HMGCS1 H.sapiens
XP_003310783.1 HMGCS1 P.troglodytes
XP_002804403.1 HMGCS1 M.mulatta
XP_005619400.1 HMGCS1 C.lupus
NP_001193507.1 HMGCS1 B.taurus
NP_666054.2 Hmgcs1 M.musculus
NP_058964.1 Hmgcs1 R.norvegicus
NP_990742.1 HMGCS1 G.gallus
NP_957379.1 hmgcs1 D.rerio
NP_725570.1 Hmgs D.melanogaster
XP_315872.3 AgaP_AGAP005847 A.gambiae
NP_013580.1 ERG13 S.cerevisiae
XP_453529.2 KLLA0D10505g K.lactis
NP_983739.1 AGOS_ADL356C E.gossypii
NP_593859.1 hcs1 S.pombe
XP_003717917.1 MGG_01026 M.oryzae
XP_957561.1 NCU03922 N.crassa
NP_192919.1 MVA1 A.thaliana
NP_001048774.1 Os03g0118800 O.sativa
NP_001062410.1 Os08g0544900 O.sativa
NP_001063706.1 Os09g0521400 O.sativa
NP_001120172.1 hmgcs1 X.tropicalis


Support Center