Display Settings:

Format

Send to:

Choose Destination
HomoloGene:141215. Gene exclusive to M.musculus Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_006541693.1       1   MMELRVSTDRELHGDERILNLKVLPHKVVFPQVRDVHLTSTLVGIEVQCK   50
XP_006541705.1       1   MMELRVSTDRELHGDERILNLKVLPHKVVFPQVRDVHLTSTLVGIEVQCK   50


XP_006541693.1      51   FEGKHGSEENLSGMVLAQVPFLKDWFYISYKKDTVLYIYQLLDDYKEGNI   100
XP_006541705.1      51   FEGKHGSEENLSGMVLAQVPFLKDWFYISYKKDTVLYIYQLLDDYKEGNI   100


XP_006541693.1     101   HIIPETPLAEARSGDDSDFLIGTWVQYTRDDRSKKIGKVVYKFLANPTVY   150
XP_006541705.1     101   HIIPETPLAEARSGDDSDFLIGTWVQYTRDDRSKKIGKVVYKFLANPTVY   150


XP_006541693.1     151   FIMFHGDLHIYIYTLVSNIT   170
XP_006541705.1     151   FIMFHGDLHIYIYTLVSNIT   170


Protein Acc. Gene Organism
XP_006541693.1 LOC102634691 M.musculus
XP_006541705.1 LOC102637471 M.musculus


Support Center