Display Settings:

Format

Send to:

Choose Destination
HomoloGene:141210. Gene exclusive to M.musculus Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_006534667.1       1   MLDAWIWGTLTLTFGLLSSLQGVSANKTANTCDILSCPKGFTCCDNECCP   50
XP_006534670.1       1   MLVTWVWGTLTLTFGLLSSLQGVSANETANTCDILSCPKGFTCCDNECCP   50


XP_006534667.1      51   ERKVWDSANNPFRILSIIICTILPVLFICALVRCIYSKCRDLQHDVRTSD   100
XP_006534670.1      51   ERKVWDSANDPFRILSIIICTILPVLFICALVKCIYSKCRDLQHDVRTSD   100


XP_006534667.1     101   HRAPPEPPSIAPLESIRVTSFDPPPRYSQLGLSITIPNVFHSWWSDMSK   149
XP_006534670.1     101   HQAPPESPSIAPLESIRVTSFDLPPRYSQLGLSITIPNVFHSWLSEMSK   149


Protein Acc. Gene Organism
XP_006534667.1 Gm11546 M.musculus
XP_006534670.1 AA623943 M.musculus


Support Center