Display Settings:

Format

Send to:

Choose Destination
HomoloGene:141208. Gene conserved in Euarchontoglires Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_006720423.1       1   MDISWDNWHKCHKTRD-----KRKPYHKKRKYELGHPAANTKTGPRRIHT   45
XP_006530102.1       1   ----MKTANNAARPGGGGGGVKRKPCHKKRKYELGRPAANTKIGPRRIHT   46


XP_006720423.1      46   VRVWGGNKKYCALRLDVRNFSWGSECCAHKTTIIDVVYNASNNELVRPKT   95
XP_006530102.1      47   VQIRGGNKKYRALRLDVGNFSWGAECCTRKTRIIDVVYNASNNELVRTKT   96


XP_006720423.1      96   LVKNCIVLIDSTLYRQWYESHYAPPLGCKKGAKLTPEEEEILNKKRSKKI   145
XP_006530102.1      97   LVKNCIVLIDSTLYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKI   146


XP_006720423.1     146   QKKYHERKKNAKISSLLGEQFQQGKLLACIASRPGQCGXADGYVLEGKEL   195
XP_006530102.1     147   QKKYEERKKNAKISSLLEEQLQQGKLLACIASRPGQCGRADGYVLEGKEL   196


XP_006720423.1     196   EFYLRKIKARKGK   208
XP_006530102.1     197   EFYLRKIKARKGK   209


Protein Acc. Gene Organism
XP_006720423.1 LOC102724737 H.sapiens
XP_006530102.1 LOC102636216 M.musculus


Support Center