Display Settings:

Format

Send to:

Choose Destination
HomoloGene:137393. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_083860.1          1   MLVSGQRKTGFTALCPELEGARGARLCPLADRFEVYEDPVWLVAGLERIA   50
XP_006228242.1           --------------------------------------------------


NP_083860.1         51   MSTDPTAQQNQTAVALQGGQAQGGMAFSDVAIYFLRGEWRLLDDSQRRLY   100
XP_006228242.1           --------------------------------------------------


NP_083860.1        101   HQVMMEVFVLMSSLGLIPSGT-DITQLGSSGNRFIPALRFLTPRV-----   144
XP_006228242.1       1   ---MMETFVLMTSLGLIPAGVRDITQLESSGDLFTPTLRFKAPGFWNREG   47


NP_083860.1        145   ELAKIPC----EQTLSTTMQQQQQQQQLSHAEKPLQRAECRISVPKRNRS   190
XP_006228242.1      48   EMSSIQCSTSPEEGVGVTVLEWQKQR---CAKKPLQRKQVRI--PAMKTG   92


NP_083860.1        191   DPSEKTLQSTDNTMDCHTLSGLHRHHVTHSAVERPKSTKRGKATPSEKRN   240
XP_006228242.1      93   DPPEKTSQSTDRVMDSQDSSRLPGSQVTPNAGQQHRNSENAESIQSKNGD   142


NP_083860.1        241   CKCYDCGKSFNCKSLLIRHRRIHTGEKPFKCSECEKSFIQKTDLNQHLKV   290
XP_006228242.1     143   HKCSDCGKTFSHKFQLIRHQKIHSGERPFKCSECGRSFQQNAHLVVHLRI   192


NP_083860.1        291   HTGEKPFRCSECGKDFKHNRSLVGHQRLHTGEKPYKCNQCGESYMNRSSL   340
XP_006228242.1     193   HTGEKRFKCSECGKAFNYKSSLIHHLNAHNGEMPYKCSQCGKLYRNKSSL   242


NP_083860.1        341   ICHYLVHTGEKPYKCGE----------------------------CGKLF   362
XP_006228242.1     243   VCHYRVHTGEKPFECSECGESYRNRDSLASHYRFHTGEKPYTCFKCGKSF   292


NP_083860.1        363   KEKSSLVYHTRVHTGERPFECSQCRKCFKKNSHLVKHQKVHSRGRPFKCN   412
XP_006228242.1     293   KEKSSLFYHGRVHNGEKPFKCSECGKCFVQKSHLVKHQNVHS--KPFMCS   340


NP_083860.1        413   VCGRYFTMRYSLIKHQRFHTAAKHHECKECGKVFCYRTGLSRHRKIH---   459
XP_006228242.1     341   ECGSVFTSGYSLIRHKRVHDTRKQYECKDCDKVYCNSSGLYKHRKVHNRQ   390


NP_083860.1        460   -AEKSIECNEHGK--   471
XP_006228242.1     391   MATKSKKSAQSPSVI   405


Protein Acc. Gene Organism
NP_083860.1 Zfp773 M.musculus
XP_006228242.1 LOC102547412 R.norvegicus


Support Center