Display Settings:

Format

Send to:

Choose Destination
HomoloGene:137324. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_059501.1          1   MWLYLVALVGLWTLLRFFRERQVVSHLQDKYVFITGCDSGFGNLLARQLD   50
NP_598227.3          1   MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLD   50


NP_059501.1         51   RRGMRVLAACLTEKGAEQLRNKTSDRLETVILDVTKTESIVAATQWVKER   100
NP_598227.3         51   RRGMRVLAACLTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKER   100


NP_059501.1        101   VGNRGLWGLVNNAGICV-FAINEWLKKEDFANILDVNLLGMIEVTLSMLP   149
NP_598227.3        101   VGNRGLWGLVNNAGISVPMGPNEWMRKKDFASVLDVNLLGVIEVTLNMLP   150


NP_059501.1        150   LVRKARGRVVNISSSMGRVSLCGGGYCISKYGVEAFSDSLRREISYFGVK   199
NP_598227.3        151   LVRKARGRVVNIASTMGRMSLLGGGYCISKYGVEAFSDSLRRELTYFGVK   200


NP_059501.1        200   VAIIEPGGFRTNVSNYERLSHSIEKLWDQTSSEVKEVYDKNFLDSYIKAI   249
NP_598227.3        201   VAIIEPGGFKTNVTNMERLSDNLKKLWDQATEEVKEIYGEKFRDSYMKAM   250


NP_059501.1        250   QSLTDTCSDDLSVVTDCMEHALTACHPRTRYSAGWDAKLFYLPLSYMPTF   299
NP_598227.3        251   ESLVNMCSGDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTF   300


NP_059501.1        300   LVDAMLYWSSVKPAQAL   316
NP_598227.3        301   LSDAVIYWGSVKPARAL   317


Protein Acc. Gene Organism
NP_059501.1 Rdh7 M.musculus
NP_598227.3 Rdh7 R.norvegicus


Support Center