Display Settings:

Format

Send to:

Choose Destination
HomoloGene:137239. Gene conserved in Euarchontoglires Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_003312987.1           --------------------------------------------------
XP_001083767.2           --------------------------------------------------
NP_035445.1              --------------------------------------------------
XP_003748908.2       1   MKEKLCSERETVSKGDCVRPKGDCSIRAVAVHIDVSSQISSARDRGHSPG   50


XP_003312987.1       1   ----------MKLSTGIIFCSLVLGVSSQGWLTFLKAAGQGTKDMWKAYS   40
XP_001083767.2       1   ----------MKLSIGIIFCSLVLGISSQRWLTFLKEAGQGSPDMWKAYS   40
NP_035445.1          1   ----------MKPSIAIILCILILGVDSQRWVQFMKEAGQGSRDMWRAYS   40
XP_003748908.2      51   VPAGVHSTSRMKSSIAIVFCLLILGVDSKRRFQFMKEAGQGTKDMWRAYS   100


XP_003312987.1      41   DMKEANYKNSDKYFHAWGNYDAVQRGLGAVWATEVISDARENVQRLTGDH   90
XP_001083767.2      41   DMKEANYKNSDKYFHAWGNYDAVQRGPGGVWAAEVINNARENVQRLTGDH   90
NP_035445.1         41   DMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHG   90
XP_003748908.2     101   DMRKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREGIQRLIGHG   150


XP_003312987.1      91   AEDSLAGQATNKWGQSGKDPNHFRPAGLPEKY   122
XP_001083767.2      91   KEDSLAGHATNKWGQSGKDPNHFRPAGLPEKY   122
NP_035445.1         91   AEDSRADQFANEWGRSGKDPNHFRPAGLPKRY   122
XP_003748908.2     151   AEDSRADQFANKWGRSGKDPNHFRPAGLPRKY   182


Protein Acc. Gene Organism
XP_003312987.1 LOC100613368 P.troglodytes
XP_001083767.2 SAA3P M.mulatta
NP_035445.1 Saa3 M.musculus
XP_003748908.2 Saal1 R.norvegicus


Support Center