Display Settings:

Format

Send to:

Choose Destination
HomoloGene:135720. Gene conserved in Euarchontoglires Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_061726.1          1   --------------------------------MVIIGPRGPGSQRLLLSL   18
NP_001076053.2       1   MYLQKRVTTHKIPQASDPLKLIVPTQRPSFSAMVIIGPRGPGSQRLLLSL   50
NP_034091.1          1   -------------------------------MSCVAMKYCHESWCLLLSL   19
NP_955780.1          1   -------------------------------MFFVAMKYCHGSWCLLLSL   19


NP_061726.1         19   LLLAAWEVGSGQLHYSVYEEAKHGTFVGRIAQDLGLELAELVPRLFRVAS   68
NP_001076053.2      51   LLLAAWEVGSGQLHYSVYEEAKHGTFVGRIAQDLGLELAELVPRLFRVAS   100
NP_034091.1         20   LLFAIWEPGSGQLRYSVPEEAKHGTFVGRIAQDLGLELTELVPRLFRVAS   69
NP_955780.1         20   LLFTIWEPGSAQLRYSVPEEAKHGTFVGRIAQDLGLELTELVPRLFRVAS   69


NP_061726.1         69   KRHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIHLEVIVDRPLQVFH   118
NP_001076053.2     101   KRHGDLLEVNLQNGILFVNSRIDREKLCGRSAECSIHLEVIVDRPLQVFH   150
NP_034091.1         70   KDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFH   119
NP_955780.1         70   KDRGDLLEVNLQNGILFVNSRIDREELCGKSAECSIHLEVIVDRPLQVFH   119


NP_061726.1        119   VDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLL   168
NP_001076053.2     151   VDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEGASDADIGVNSLL   200
NP_034091.1        120   VEVEVRDINDNPPVFPTTEKNLFVSESRALDPHFSLEGASDADIGTNALL   169
NP_955780.1        120   VEVEVKDINDNPPVFPTTQKNLFVSETRALDSRFSLEGASDADIGTNALL   169


NP_061726.1        169   TYALSLNENFELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGG   218
NP_001076053.2     201   TYALSLNEHFELKIKTKKDKSILPELVLRKLLDREQTPKLNLLLMVIDGG   250
NP_034091.1        170   TYRLSPSEYFSLEVPTTDELVKPLQLVLKKPLDRERASELHLVVKATDGG   219
NP_955780.1        170   TYRLSPSEYFSLEVPTTDELVKPLELVLKKPLDRERDSELHLVVKATDGG   219


NP_061726.1        219   KPELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASD   268
NP_001076053.2     251   KPELTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASD   300
NP_034091.1        220   KPELTGTLELHITVLDANDNAPAFDRAIYRVKLVENARNGTVVIRLNASD   269
NP_955780.1        220   KPELTGTLELHITVLDANDNAPAFDRAIYRVKLVENARNGTLVIRLNASD   269


NP_061726.1        269   PDEGLNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEI   318
NP_001076053.2     301   PDEGLNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEI   350
NP_034091.1        270   LDEGSNGQILYSFAADVSPKTEATFHIDSVSGEIKVNGKIDFEETNLWKI   319
NP_955780.1        270   LDEGSNGQILYSFAADIPPKTEATFHIDPVSGEIKVNGKIDFEETNLWKI   319


NP_061726.1        319   QVNAIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLPVQEDAQVGTV   368
NP_001076053.2     351   QVNAIDKGIPSMAGHSMVLVEVLDVNDNVPEVMVTSLSLPVQEDAQVGTV   400
NP_034091.1        320   QAEAVDKGSPPMFGHCTILIEVLDINDNAPKIIVTSLSLPVQEDAPVGTV   369
NP_955780.1        320   QAEAVDEGSPPMFGHCTILIEVLDINDNAPKLIVTSLSLPIREDAPVGTV   369


NP_061726.1        369   IALISVSDRDSGANGQVICSLTPHVPFKLVSTYKNYYSLVLDSALDRESV   418
NP_001076053.2     401   IALISVSDRDSGANGQVICSLTPHVPFKLVSTYKNYYSLVLDSALDRESV   450
NP_034091.1        370   IALISVMDPDSTVNGQVTCSLSPHVPFKLVSTFKNYYSLVLDSALDRETT   419
NP_955780.1        370   IALISVTDPDSTVNGQVTCSLTPQVPFKLVSTFKNYYSLVLDSALDRETT   419


NP_061726.1        419   SAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENN   468
NP_001076053.2     451   SAYELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENN   500
NP_034091.1        420   ADYKVVVTARDGGSPALWATASVSVEVADVNDNAPAFAQSEYTVFVKENN   469
NP_955780.1        420   ADFKVVVTARDRGSPSLWDTASVSVEVADVNDNAPAFAQPEYTVFVKENN   469


NP_061726.1        469   PPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSSYVSVHAESGKVY   518
NP_001076053.2     501   PPGCHIFTVSAWDADAQKNALVSYSLVERRVGEHALSSYVSVHAESGKVY   550
NP_034091.1        470   PPGVHVFTVLAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKVF   519
NP_955780.1        470   PPGAHIFTVSAVDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKVF   519


NP_061726.1        519   ALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAT   568
NP_001076053.2     551   ALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAT   600
NP_034091.1        520   ALQPLDHEELELLQFQVTAKDAGVPALGSNVTLQVFVLDENDNAPTLLPH   569
NP_955780.1        520   ALQPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLPH   569


NP_061726.1        569   PAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGA   618
NP_001076053.2     601   PAGSAGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPAAVGA   650
NP_034091.1        570   GAVGAGGAVSELVPRSVGSGHVVAKVRAVDADSGYNAWLSYELQFRAGSV   619
NP_955780.1        570   GAVGAGGAVSELVPRSVGSGHVVAKVRAVDADSGYNAWLSYELQFGAGSV   619


NP_061726.1        619   HIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDHGEPALTSTATVLVS   668
NP_001076053.2     651   HIPFHVGLYTGEISTTRILDEADAPRHRLLVLVKDHGEPALTSTATVLVS   700
NP_034091.1        620   RSPFRVGLYTGEISITRALDEADAPRQRLLVLVKDHGEPALTATATVLVS   669
NP_955780.1        620   RSPFRVGLYTGEISITRALDEVDAPRQRLLVLVKDHGEPALTATATVLVS   669


NP_061726.1        669   LVENGQAPKTSSRASVGAVDPEAALVDINVYLIIAICAVSSLLVLTLLLY   718
NP_001076053.2     701   LVENGQAPKTSSRASVGAVDPEAALVDINVYLIIAICAVSSLLVLTLLLY   750
NP_034091.1        670   LVESNQAPKASSRVL-GPAASESSVVDVNVYLIIAICAVSSLLVLTLVLY   718
NP_955780.1        670   LIESNQAPKASSRVLAGTAASESPVVDVNVYLIIAICAVSSLLVLTLVLY   719


NP_061726.1        719   TALRCSAPPTVSRCAPGKPTLVCSSAVGSWSYSQQRRQRVCSAESPPKTD   768
NP_001076053.2     751   TALRCSAPPTVSRCAPGKPTLVCSSAVGSWSYSQQRRQRVCSGESPPKTD   800
NP_034091.1        719   TALRCSALPTEVTCGPGKPMLVCSSAVGSWSYSQQRRQRVCSGEGPPKTD   768
NP_955780.1        720   TALRCSALPTEVTCGPGKPMLVCSSAVGSWSYSQQRRQRVCSGEGPPKTD   769


NP_061726.1        769   LMAFSPSLQ--LSREDC---LNPPSEPRQPNPDWRYSASLRAGMHSSVHL   813
NP_001076053.2     801   LMAFSPSLQ--LSREDC---LNPPSEPRQPNPDWRYSASLRAGMHSSVHL   845
NP_034091.1        769   LMAFSPSVPPGLGSGDSGVQQEIFENPRQPNPDWRYSASLRAGMHSSVHL   818
NP_955780.1        770   LMAFSPSVPPGLGSGDSGVQQEIFENPRQPNPDWRYSASLRAGMHSSVHL   819


NP_061726.1        814   EEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYG   863
NP_001076053.2     846   EEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYG   895
NP_034091.1        819   EEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYG   868
NP_955780.1        820   EEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYG   869


NP_061726.1        864   PGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDKSDFITFGKKEET   913
NP_001076053.2     896   PGNPKQSGPGELPDKFIIPGSPAIISIRQEPANSQIDKSDFITFGKKEET   945
NP_034091.1        869   PGNPKQSGPGELPDKFIIPGSPAIISIRQEPANNQIDKSDFITFGKKEET   918
NP_955780.1        870   PGNPKQPGPGELPDKFIIPGSPAIISIRQESANNQIDKSDFITFGKKEET   919


NP_061726.1        914   KKKKKKKKGNKTQEKKEKGNSTTDNSDQ   941
NP_001076053.2     946   KKKKKKKKGNKTQEKKEKGNSTTDNSDQ   973
NP_034091.1        919   KKKKKKKKGNKTQEKKEKGNSTTDNSDQ   946
NP_955780.1        920   KKKKKKKKGNKTQEKKEKGNSTTDNSDQ   947


Protein Acc. Gene Organism
NP_061726.1 PCDHA12 H.sapiens
NP_001076053.2 PCDHA12 P.troglodytes
NP_034091.1 Pcdha10 M.musculus
NP_955780.1 Pcdha11 R.norvegicus


Support Center