Display Settings:

Format

Send to:

Choose Destination
HomoloGene:13547. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001121895.1       1   -MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRL-Q--------G   40
XP_001108380.1       1   -MAGWWPALSRAARRHPWPTNVLLYGSLYSAGDALQQRL-Q--------G   40
NP_001040067.1       1   -MVSWWQALTRAAGRYPWPANVLLYAGFFSGGDALQQVL-R--------G   40
NP_291042.2          1   -MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRL-R--------G   40
XP_002727743.1       1   -MANWWRAFPRAARRYPWPTNVLLYAGLFSAGDALQQRL-R--------G   40
XP_691639.1          1   MRKSFFKRLKR-AKILPWISNVTLYGCLFAGGDFVHQCIAQ--------R   41
NP_001097610.1       1   -MARLISGVRNLFHRYPFVTNSAIYGSLYVGAEYSQQFASKRWLATASKP   49
XP_320168.4          1   -MATFLRAFGRFFTKHPLAGNGLVYGTLYVGAEFSQQTITRKLLTDP--P   47
XP_004916280.1       1   -----MRILVQFTKRHPWLTNVTIYGSLFASADIVQQKLSKSP------G   39


NP_001121895.1      41   REANWRQTRRVATLVVTFHANFNYVWLRLLERALPGRAPHALLAKLLCDQ   90
XP_001108380.1      41   CEADWRQTRRVATLAVTFHANFNYVWLGLLERALPGRAPRAVLAKLLCDQ   90
NP_001040067.1      41   GPADWQHTRHVATVAVAFHANLNYVWLNLLERALPGRAPRTILAKVLCDQ   90
NP_291042.2         41   GPADWRQTRRVATLAVTFHGNFNYVWLRLLERALPGRAPRTVLAKVLCDQ   90
XP_002727743.1      41   GPADWRQTRRVATLALTFHGNFNYMWLRLLERALPGRAPRTVLAKVLCDQ   90
XP_691639.1         42   DEMDWRHTRNVAIVALSFQGNFNYFWLRALESRFPGRSAGMVFRKLVLDQ   91
NP_001097610.1      50   EDIDYATIGRYAVMGTAVYAPTLYLWYKWLDRAFPGTTKVIIVKKLVLDQ   99
XP_320168.4         48   QDIDRPTLARYAVMGTFIYSPILYNWYKWLDKTFPGTAKRIIVKKLLLDQ   97
XP_004916280.1      40   EPIDFKQTAKVGIVGFCFHANFNFFWLRFIERTFPGSAPLNVIRKVACDQ   89


NP_001121895.1      91   VVGAPIAVSAFYVGMSILQGKDDIFLDLKQKFWNTYLSGLMYWPFVQLTN   140
XP_001108380.1      91   VVGAPIAVSAFYTGMSILQEKDDIFLDLKQKFWNTYLSGLVYWPFVQLTN   140
NP_001040067.1      91   ALGGPVYVSTFYAGMSILQGKDDIFLDMRQKFWNTYKSGLMYWPFVQLIN   140
NP_291042.2         91   TVGGPIALSAFYVGMSVLQGKDDIFLDLKQKFWNTYKSGLMYWPFVQLTN   140
XP_002727743.1      91   TVGGPVALSAFYVGMSILQGKDDIFLDLRQKFWNTYKTGLMYWPFVQLTN   140
XP_691639.1         92   SFASPLATSVFYTGVSFLEGKEDIFEDWREKFFNTYKTGLMYWPFMQFLN   141
NP_001097610.1     100   FVLTPYLLTVFYAGMSIMEGSADIFLELREKFVPTFMRSCIFWLPAQALN   149
XP_320168.4         98   FILTPPLLVIFFTGMSLMERQSSITEECRQKFLPTFARSCLFWMPAQTLN   147
XP_004916280.1      90   LMAAPITISAFYTGLSLLDGESDIFKNLKEKFWPTYKTGVMCWTVFQTIN   139


NP_001121895.1     141   FSLVPVQWRTAYAGVCGFLWATFICF--SQQSGDGTFKSAFTILYTKGTS   188
XP_001108380.1     141   FSLVPVQWRTAYTGVCGFLWAIFVCF--SQQSGDGTLKSAFTIFRTKWTS   188
NP_001040067.1     141   FSLIPIRWRTAYTGLCGFLWATFLCF--SQQEGDGTFKSAFTFRRIKVTN   188
NP_291042.2        141   FSLVPVHWRTAYTGLCAFLWATFLCF--SQQSGDGTLQSIFIFLRRK--E   186
XP_002727743.1     141   FSLVPVNWRTAYTGLCGFLWATFLCF--SQQSGDGTVESIFILLRRK--E   186
XP_691639.1        142   FVLMPLYLRTAFMGCSAFVWATFLCF--SRQSGDGTAAVALAWVMAPKKR   189
NP_001097610.1     150   FSLVAPRFRVIYMGICGLIWVNILCW---------TKRQSLPVATKEIAT   190
XP_320168.4        148   FVLVPPKFRVVYVGSCAFAWVNILCW---------VKRQKMLSSN-----   183
XP_004916280.1     140   FSVIPPFVRTAYIGVCAFLWTTFLCYIRNRDINEVTSRLLHAVPSIRGKV   189


NP_001121895.1     189   ATEGYPKK------   196
XP_001108380.1     189   AIEGSPEK------   196
NP_001040067.1     189   EVEKPSEK------   196
NP_291042.2        187   ASDKSPEK------   194
XP_002727743.1     187   AGDRSPEK------   194
XP_691639.1        190   LLHRSTDEEK----   199
NP_001097610.1     191   DSNNNAAAIRNSET   204
XP_320168.4              --------------
XP_004916280.1     190   AFQQDKDDNKTDTK   203


Protein Acc. Gene Organism
NP_001121895.1 MPV17L H.sapiens
XP_001108380.1 LOC713693 M.mulatta
NP_001040067.1 MPV17L B.taurus
NP_291042.2 Mpv17l M.musculus
XP_002727743.1 LOC100362572 R.norvegicus
XP_691639.1 LOC563178 D.rerio
NP_001097610.1 CG12355 D.melanogaster
XP_320168.4 AgaP_AGAP012390 A.gambiae
XP_004916280.1 LOC100493944 X.tropicalis


Support Center