Display Settings:

Format

Send to:

Choose Destination
HomoloGene:134588. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1       1   MGTRVKQRSHFGQRQVLFPFLLPLFCGGLSEQIRYSIPEEMAKGSVVGNL   50
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1      51   AKDLGLHVEDLLNRNLRISAEKQYFTINTENGNIFVSERIDRESLCLQNP   100
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     101   QCIVPLEIVAENPLNVFHVLVRVEDINDNTPYFPQNSIVLQINEFAMLGT   150
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     151   RFGMESAIDADVGPNSLQSYQLSHNEHFSLLVKDKTAGKNAPELILEKPL   200
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     201   DREHQSSHLLVLTAMDGGDPVQSGTIQIKIEVTDANDNAPVFSQDVYKVS   250
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     251   LPENLPSGTSVLKVTAIDQDEGINAEITYSFKTLRDIGNMFILDHQSGEI   300
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     301   KSKGPIDFEISRSYTINIEAKDGGGMATECKIIVEILDENDNAPEVIFTS   350
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     351   VSSSITEDTEHGMVIALFKTHDKDSGENGEVTCLIKEKVPFKIESSANNY   400
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     401   YKLVTDGALDREKTSSYNVTITATDRGKPPLSSSSSITLHITDVNDNAPV   450
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     451   FQQASYVVHVAENNPPAASIAQVSASDPDLGPNGRVSYSIVASDLEPRAL   500
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     501   ASYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVL   550
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     551   VGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHN   600
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     601   AWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQ   650
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     651   PPLSATATLLLVFADSLQEALPDVSERQAPADPQAELQFYLVVALALISV   700
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     701   LFLLAVILAVALRLGRSSSSTTWGCLRPGLCVKSGPVVPPNCSEGTLPYA   750
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     751   YNLCIASDSQKARLNFRTMTKEMGPPQDLSNEASLEISVTEENNKLSTNS   800
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1              --------------------------------------------------
NP_001076036.2           --------------------------------------------------
XP_005617963.1     801   DASVRTSNFIISPQTSILKYFDNFTCDSLHPPTHKISCSVTSGYYDAVAT   850
NP_291073.1              --------------------------------------------------
NP_001032414.1           --------------------------------------------------


NP_003726.1          1   ------------MIPARLHRDYKGLVLLGILLGTLWETGCTQIRYSVPEE   38
NP_001076036.2       1   ----------MRMIPARLHRDYKGLVLLGILLGTLWETGCTQIRYSVPEE   40
XP_005617963.1     851   EEVEVISSRKVAMMPKRLHQDCKGLVLLGVLLGILWDTGCTQIHYLVPVE   900
NP_291073.1          1   ------------MIPMQRREDCKGLVFLGVLLGMLWKAGSTQIRYSVPEE   38
NP_001032414.1       1   ------------MIPMQRPEDCKGLVFLGVFFGMLWEAGSTQIRYSVPEE   38


NP_003726.1         39   LEKGSRVGDISRDLGLEPRELAERG----VRIIPRGRTQLF-ALNPRSGS   83
NP_001076036.2      41   LEKGSRVGDISRDLGLEPRELAERG----VRIIPRGRTQLF-ALNPRSGS   85
XP_005617963.1     901   LEKGSRVGNIAKDLGLEPQELEERSPEPRARIVSKGRSQLFNPLNPRSGS   950
NP_291073.1         39   LEKGSRVGNISKDLGLEPRELEKRG----VRIVSRGRAQLF-ALNPRSGS   83
NP_001032414.1      39   LEKGSRVGNISKDLGLEPRELAERG----VRIVSRGRAQLF-ALNPRSGS   83


NP_003726.1         84   LVTAGRIDREELCMGAIKCQLNLDILMEDKVKIYGVEVEVRDINDNAPYF   133
NP_001076036.2      86   LVTAGRIDREELCMGAIKCQLNLDILMEDKVKIYGVEVEVRDINDNAPYF   135
XP_005617963.1     951   LISAGRIDREELCMGVFSCQLNLEILLEGKVKIYGVVAEVRDINDNAPYF   1000
NP_291073.1         84   LVTAGRIDREELCMGSIKCQLNLEILMEDIGKIYGVEIEVRDINDNAPYF   133
NP_001032414.1      84   LVTAGKIDREELCMGSIKCQLNLEILMEDIGKIYGVEIEVRDINDNAPYF   133


NP_003726.1        134   RESELEIKISENAATEMRFPLPHAWDPDIGKNSLQSYELSPNTHFSLIVQ   183
NP_001076036.2     136   RESELEIKISENAATEMRFPLPHAWDPDIGKNSLQSYELSPNTHFSLIVQ   185
XP_005617963.1    1001   QEDELEIKMSENAVTGLRFPLPHAWDLDFRKNALQRYRLSSNTHFSLDVQ   1050
NP_291073.1        134   RESELEIKMSENAAAGMRFPLPHAWDPDIGKNSLQSYQLSPNAHFSLEVQ   183
NP_001032414.1     134   RESELEIKMSENAAAGMRFPLPHAWDPDIGKNSLQSYQLSPNAHFSLEVQ   183


NP_003726.1        184   NGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVL   233
NP_001076036.2     186   NGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVL   235
XP_005617963.1    1051   SGADDNKYPELVLECALDREQKAVHHLVLTASYGGDPVHRNRTRIQVMVV   1100
NP_291073.1        184   NGADGNKYPELVLESSLDREEKAAHLLVLTASDAGDPVRTGTARIRVMVV   233
NP_001032414.1     184   KGADGNKYPELVLESSLDREEKAAHLLVLTASDAGDPVRSGTARILVTVL   233


NP_003726.1        234   DANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRY   283
NP_001076036.2     236   DANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRS   285
XP_005617963.1    1101   DVN-NTPVFAQPEYHVSVPENVAIGTKLLLVSATDPDEGATAEVMYSFLY   1149
NP_291073.1        234   DANDNAPAFARSEYRVSVRENVAVGTQLLLVNATDPDEGANAEVIYSFRY   283
NP_001032414.1     234   DANDNAPAFARSEYRVNVRENVAVGTQLLLVNATDRDEGSNAEVIYSFRY   283


NP_003726.1        284   VDDKAA--QVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARA   331
NP_001076036.2     286   VDDKAA--QVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARA   333
XP_005617963.1    1150   VDKKAAQVQVFKVDANLGTVXTIGELNYEE--XYEMEVQAMDDSGYSARA   1197
NP_291073.1        284   VDDKAA--KVFKLDSNLGTISTIGELNHEESGFYEMEVQATDNAGYSARA   331
NP_001032414.1     284   VDDKAA--KVFKLDSNLGTISTIGELNHEESGFYEMEVQATDNAGFSARA   331


NP_003726.1        332   KVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQ   381
NP_001076036.2     334   KVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQ   383
XP_005617963.1    1198   IVLITVLDVNHNIPEVVVTSLSSSILENTPRGTLIALLNVNDQDSGENRQ   1247
NP_291073.1        332   KVLVTVLDVNDNAPEVAITSLTNSVPENSPQGTLIALLNVNDQDSGENGQ   381
NP_001032414.1     332   KVLVTVLDVNDNAPEVAITSLNSPVPENSPRGTLIALLNVNDQDSGENGQ   381


NP_003726.1        382   VICFIQGNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPP   431
NP_001076036.2     384   VICFIQGNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPP   433
XP_005617963.1    1248   VTCFIXGNLEFKLEKSYGNYHSLVTDALLDWEQVPSY-ITVTASDIGSPS   1296
NP_291073.1        382   VICSIQENLPFKLEKSYGNYYRLVTDAVLDREEVPSYNITMTATDRGSPP   431
NP_001032414.1     382   VICSIQENLPFKLEKSYGNYYSLLTDAVLDREQVPSYNITVTATDRGSPP   431


NP_003726.1        432   LSTETHISLNVADTNDNPPVFPQASYSAYIPENNPR--GVSLVSVTAHDP   479
NP_001076036.2     434   LSTETHISLNVADTNDNPPVFPQASYSAYIPENNPR--GVSLVSVTAHDP   481
XP_005617963.1    1297   LSTETHISLKIADTNDXPPIFSDPFYSAFIVENNSNVPTASIMSVTAYDP   1346
NP_291073.1        432   LTTETHLALDIADTNDNSPVFLQASYWAYIPENNPR--GASIASVTAHDP   479
NP_001032414.1     432   LTTETHLSLNVADANDNPPIFLQASYWAYIQENNPR--GASIASVTAHDP   479


NP_003726.1        480   DCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQ   529
NP_001076036.2     482   DCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQ   531
XP_005617963.1    1347   DYGENAQVTYSLVEDTLPGPPLSSYISINSNTGVLYALHSFDYEQLQDLQ   1396
NP_291073.1        480   DSDKNAQVTYSLAEDTHQGVPLSSYVSINSDTGVLYALHSFDYEQFPDLQ   529
NP_001032414.1     480   DSDKNAQVTYSLAEDTHQGVPLSSYVSINSDTGVLYALHSFDYEQFPDLQ   529


NP_003726.1        530   VKVMARDNGHPPLSSNVSLSLFVLDQN--DNAPEILYPALPTDGSTGVEL   577
NP_001076036.2     532   VKVMARDNGHPPLSSNVSLSLFVLDQN--DNAPEILYPALPTDGSTSVEL   579
XP_005617963.1    1397   LQVMAYNSSX-PLSSNVPLSLSVLDQNRQNDVPEILYPILPTDRSTGMEL   1445
NP_291073.1        530   LQVIARDSGDPPLSSNVSLSLFVLDQN--DNVPEILYPTLPTDGSTGVEL   577
NP_001032414.1     530   LQVIARDSGEPPLSSNVSLSLFVLDQN--DNTPEILYPTLPTDGSTGVEL   577


NP_003726.1        578   APRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVR   627
NP_001076036.2     580   APRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVR   629
XP_005617963.1    1446   ASRSTEPGYLVTKVVAVDKDSGQNAWLSYHLLKASEPGLFQVGLHTGEVR   1495
NP_291073.1        578   APRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEIS   627
NP_001032414.1     578   APRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVS   627


NP_003726.1        628   TARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPQVLADLGS   677
NP_001076036.2     630   TARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVANSIPQVLADLGS   679
XP_005617963.1    1496   TARALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAIADSIPDVLADLGS   1545
NP_291073.1        628   TARALMDRDALKQNLVVSVQDHGQPPLSATVTLTVAIADSIPDVLADLDN   677
NP_001032414.1     628   TARALMDRDALKQNLVVSVQDHGQPPLSATVTLTVAIADSIPDVLADLDN   677


NP_003726.1        678   LESPANSETSDLTLYLVVAVAAVSCVFLAFVILLLALRLRRWHKSRLLQA   727
NP_001076036.2     680   LESPANSETSDLTLYLVVAVAAVSCVFLAFVILLLALRLRRWHKSRLLQA   729
XP_005617963.1    1546   LEAPRDSQASDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHASRLLQA   1595
NP_291073.1        678   LESPSTSETSGLTLYLVVAVAAVSTVFLVFVLVLLALRLRRWHSLRLLRA   727
NP_001032414.1     678   LESPTTSETSGLTLYLVVAVAAVSMVFLVFVLVLLALRLRRWHSLRLLRA   727


NP_003726.1        728   SGGGLTGAP--ASHFVGVDGVQAFLQTYSHEVSLTTDSRKSHLIFPQPNY   775
NP_001076036.2     730   SGGGLTGAP--ASHFVGVDGVQAFLQTYSHEVSLTTDSRRSHLIFPQPNY   777
XP_005617963.1    1596   AGGGLLGAPASASQFVGVDGVRAFLQTYSHEVSLTAGSRESHVIFPQPNY   1645
NP_291073.1        728   GGPGLADVA--ASHFVGVDGVQAFLQTYSHEVSLTAGSRKSHLIFPQPNY   775
NP_001032414.1     728   AGPGLADVA--ASRFVGVDGVQAFLQTYSHEVSLTAGSRKSHLIFPQPNY   775


NP_003726.1        776   ADMLVSQESFEKSEPLLLSGDSVFSKDSHGLIEQAPPNTDWRFSQAQRPG   825
NP_001076036.2     778   ADMLVSQESFEKSEPLLLSGDSVFSKDGHGLIEQAPPNTDWRFSQAQRPG   827
XP_005617963.1    1646   ADTLLSQESCGKSEPLLLSGGSAFFKDNHALIQQAPPNTDWRFSQAQRPG   1695
NP_291073.1        776   ADTLISQESCEKTEPLLPSGDSVFSKDNHALNQQAPPNTDWRFSQAQRPG   825
NP_001032414.1     776   ADTLISQESCEKTEPLLPSSDLVFSKDNHALNQQAPPNTDWRFSQAQRPG   825


NP_003726.1        826   TSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGL   875
NP_001076036.2     828   TSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGL   877
XP_005617963.1    1696   TSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGL   1745
NP_291073.1        826   TSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGL   875
NP_001032414.1     826   TSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGTGTMGL   875


NP_003726.1        876   SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKK   925
NP_001076036.2     878   SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKK   927
XP_005617963.1    1746   SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGSKKK   1795
NP_291073.1        876   SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKK   925
NP_001032414.1     876   SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKK   925


NP_003726.1        926   SGKKEKK   932
NP_001076036.2     928   SGKKEKK   934
XP_005617963.1    1796   SGKKEKK   1802
NP_291073.1        926   SGKKEKK   932
NP_001032414.1     926   SGKKEKK   932


Protein Acc. Gene Organism
NP_003726.1 PCDHGA12 H.sapiens
NP_001076036.2 PCDHGA12 P.troglodytes
XP_005617963.1 PCDHGA12 C.lupus
NP_291073.1 Pcdhga12 M.musculus
NP_001032414.1 Pcdhga12 R.norvegicus


Support Center