Display Settings:

Format

Send to:

Choose Destination
HomoloGene:13200. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_149022.3          1   MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALG   50
XP_522390.2          1   MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGGGLRALG   50
XP_001093789.1       1   MSYHSFQPGSRCGGQSFSSYSAVMPRMVTHYAVSKGPCRPGGGGGLRALG   50
XP_543651.2          1   MSCRSFQLGSRCGGQSFSSCSAVLPRMVAHHAVSKGPCRPGGGGGLRALG   50
NP_001076085.1       1   MSCRSFQQGFRCGGQSFSSCSAVLPRVVTHYAVSQGPCRTGGSGSFRALG   50
NP_444479.2          1   MSCRNFQLSPRCGNRSFSSCSAIMPRMVTHYEVSKAPCRSGGGGGLRALG   50
NP_001008803.1       1   -----------------------MPRMVTHYEVSKVPSRPGVGGGLRALG   27


NP_149022.3         51   CLGSRSLCNVGFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINES   100
XP_522390.2         51   CLGSRSLCNVGFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINES   100
XP_001093789.1      51   CLSSRSLCNVGFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINES   100
XP_543651.2         51   CLGSRSLCNVGFGRPRVASRCG--LPSFGYRVGAVSGPSACIAPVTINES   98
NP_001076085.1      51   CLGSRSLCNVGFGQPRVASRCG--LPGFGYRAGTTCGSSACIAPVTINES   98
NP_444479.2         51   CLGSRSLCNVGFGRPRVASRCG--MPGFGYRAGATCGSSACITPVTINES   98
NP_001008803.1      28   CLGSRSLCNVGFGRPRVASRCG--MPGFGYRAGAACGSPACITPVTINES   75


NP_149022.3        101   LLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLET   150
XP_522390.2        101   LLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLET   150
XP_001093789.1     101   LLVPLALDIDPTVQRVKRDEKEQIKCLNNRFASFINKVRYLEQKNKLLET   150
XP_543651.2         99   LLVPLELEIDPAVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLET   148
NP_001076085.1      99   LLVPLELEVDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLET   148
NP_444479.2         99   LLVPLELEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLET   148
NP_001008803.1      76   LLVPLELEIDPTVQSVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLET   125


NP_149022.3        151   KWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAA   200
XP_522390.2        151   KWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAA   200
XP_001093789.1     151   KWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQDA   200
XP_543651.2        149   KWNFMQQQRCCQSNIEPIFEAYICALRRQLDCVAGDRARLESELCSLQDA   198
NP_001076085.1     149   KWNFMQQQKCCSSNIEPIFEGYISTLRRQLDFLTGDRDRLESEFHCLHDT   198
NP_444479.2        149   KWNFMQQQRSCQSNMEPLFEGYICALRRQLDCVSGDHGRLEAELCSLQEA   198
NP_001008803.1     126   KWNFMQQQRSCQSNMEPLFEGYICALRRQLDCVSGDHGRLEAELCSLQEA   175


NP_149022.3        201   LEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEI   250
XP_522390.2        201   LEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEI   250
XP_001093789.1     201   LEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEI   250
XP_543651.2        199   LESYKKKYEEELSLRPCAENEFVALKKEVDTAFLIKADLETNAEALVQEI   248
NP_001076085.1     199   LEGYKKKYEEELSLRPTAENEFVALKKDVDTAFLINSDLEINVEALIHEI   248
NP_444479.2        199   LEGYKKKYEEELSLRPCAENEFVTLKKDVDTAFLVKADLETNLEALEHEI   248
NP_001008803.1     176   LEGYKKKYEEELSLRPCAENEFVTLKKDVDTAFLVKADLETNLEALEHEI   225


NP_149022.3        251   DFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIA   300
XP_522390.2        251   DFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDSIIAEIKAQYDDIA   300
XP_001093789.1     251   DFLKGLYEEEICLLQSQISETSVIVKMDNSRELDVDGIVAEIKAQYDDIA   300
XP_543651.2        249   DFLKGLYEEEMCLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIA   298
NP_001076085.1     249   NFLKTLYTEETNLLQSQISDTSVTVKMDNSRELDTDGIIAQIKAQYDEIA   298
NP_444479.2        249   EFLKALFEEEIGLLQSQISETSVIVKMDNSRELDVDGIVAEIKAQYDDIA   298
NP_001008803.1     226   EFLKALFEEEISLLQSQISETSVIVKMDNSRDLDVDGIVAEIKAQYDDIA   275


NP_149022.3        301   SRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQET   350
XP_522390.2        301   SRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQWLQQET   350
XP_001093789.1     301   SRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQEI   350
XP_543651.2        299   SRSKAEAEAWYQSRYEELRLTAGNHCDNLRNRKNEILEMNKLIQRLQQEI   348
NP_001076085.1     299   NRSKAEAEAWYQSRYEELQLTAGNHCDNLRNRKNEILEINKLIQRLQQDI   348
NP_444479.2        299   SRSKAEAEAWYQCRYEELRLTAGNHCDNLRNRKNEILEMNKLIQRLQQDI   348
NP_001008803.1     276   SRSKAEAEAWYQCRYEELRMTAGNHSDNLRNRKNEILEMNKLIQRLQQDI   325


NP_149022.3        351   ENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLL   400
XP_522390.2        351   ENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLL   400
XP_001093789.1     351   ENVKAQRCKLEGAITEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLL   400
XP_543651.2        349   EAVKAQRCKLEAAVTQAEQQGEAALGDAKCKLAGLEAALQKAKQDMACLL   398
NP_001076085.1     349   ENVKAQRCKLEAAVTQAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLL   398
NP_444479.2        349   EAVKGQRCKLEGAIAQAEQQGEAALTDAKCKLAGLEEALQKAKQDMACLL   398
NP_001008803.1     326   ETVKAQRCKLEGAIAQAEQQGEAALSDAKCKLAGLEEALQKAKQDMACLL   375


NP_149022.3        401   KEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAFL   450
XP_522390.2        401   KEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAFL   450
XP_001093789.1     401   KEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAIL   450
XP_543651.2        399   KEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAVL   448
NP_001076085.1     399   KEYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEGVGPVNISVSSSKGAIL   448
NP_444479.2        399   KQYQEVMNCKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAVL   448
NP_001008803.1     376   KEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAVL   425


NP_149022.3        451   YEPCGVSTPVLST-------GVLRSNGGCSIVGTGELYVPCEPQGLLSCG   493
XP_522390.2        451   YEPCGVSTPVLST-------GVLRSNGGCSIVGTGELYVPCEPQGLLSCG   493
XP_001093789.1     451   YEPCGVSTPVLST-------GVLRSSGGCSIVGTGELYVPCEPQGLLSCG   493
XP_543651.2        449   YEPCTVSTPVLRTEYCPGAPGVLKSSGGCSVVGSGEVYIPCEPQGVLGCV   498
NP_001076085.1     449   YEPCVVSTPV----YCPGSTSVLKSSGGCGIVGTSEIYIPCEPQGLLVCG   494
NP_444479.2        449   YEPCVMGTPMLRTEYCTGTTGVLRNSGGCNVVGTGELYIPCEPQGLLGCG   498
NP_001008803.1     426   YEPCVVGTPMLRTEYCTGATGVLRNSGGCSVVGTGELYIPCEPQGLLGCG   475


NP_149022.3        494   SGRKSSMTLGAGGSSPSHKH   513
XP_522390.2        494   SGQKSSMTLGAGGSSPSHKR   513
XP_001093789.1     494   SGRNSSTKLGAGGSSSSHKC   513
XP_543651.2        499   SGRSPSTKVGAGGSASPHKC   518
NP_001076085.1     495   SRRSSGVKLGAGGSASCHKC   514
NP_444479.2        499   NGRSSSMKVGVGSNSCSR--   516
NP_001008803.1     476   SGRSSSMKMGAGSNSCSH--   493


Protein Acc. Gene Organism
NP_149022.3 KRT82 H.sapiens
XP_522390.2 KRT82 P.troglodytes
XP_001093789.1 KRT82 M.mulatta
XP_543651.2 KRT82 C.lupus
NP_001076085.1 KRT82 B.taurus
NP_444479.2 Krt82 M.musculus
NP_001008803.1 Krt82 R.norvegicus


Support Center