Display Settings:

Format

Send to:

Choose Destination
HomoloGene:130765. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_082871.2          1   -------------------MIPQVVTNETITTISPNGINFPQKDESQPTQ   31
XP_006231175.1       1   MVEVIEERQRASSSPGNSIMIPQVVTNETITLISPNGTNFPQTDKLQPTV   50


NP_082871.2         32   QRQDSLKKHLKAEIKVIVAIQIMCAVTVLALGIILASVPPVPYFNSVFSV   81
XP_006231175.1      51   KRQVSLKKHLKAEIKVMAAIQIMSAVMVLGLGIILASVPPVLHFTSVFSV   100


NP_082871.2         82   LLKSGYPFI--GALFFIASGILSIITERKSTKPLVDASLTLNILSVSFAF   129
XP_006231175.1     101   LLKSGYPFIIQEITKFIISGILSIITERKSTNPLVDGSLTLNILSVSFAF   150


NP_082871.2        130   VGIIIISVSLAGLHPASEQCKQSKELSLIEHDYYQPFYNSDRSECAVTKS   179
XP_006231175.1     151   MGIIIISVSLAGLHPASEQCKLSKDPRPTEHHYYHISYDSDRNECSVTNS   200


NP_082871.2        180   ILTGALSVMLIISVLELGLALLSAMLWLREGVLTSLRM   217
XP_006231175.1     201   VLAGALTVMLINTLLELVLAGLSVMLWSKEGALTSLR-   237


Protein Acc. Gene Organism
NP_082871.2 Ms4a6c M.musculus
XP_006231175.1 Ms4a6c R.norvegicus


Support Center