Display Settings:

Format

Send to:

Choose Destination
HomoloGene:12822. Gene conserved in Tetrapoda Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_619729.1          1   ------------------MEQWDHFHNQQEDTDSCSE--SVKFDARSMTA   30
XP_001140701.2       1   MCYLSAIISISLLNKKPSMEQWDHFHNQQEDTDSCSE--SVKFDARSMTA   48
XP_001097884.1       1   ---------------------------MEPEYLKCED--QSHNQTRGEGA   21
XP_848261.1          1   ------------------MEPWDRFPDHQDDPDNYSE--SVKFDARSMTA   30
NP_001106711.1       1   ------------------MAQWDDFPDQQEDTDSCTE--SVKFDARSVTA   30
NP_001106797.1       1   -------------MTKEMTENQRLCPHEQEDADCSSE--SVKFDARSMTA   35
NP_001178868.1       1   -----------------MIEKQRLCPPEPEDADCYSE--SVKFDARSMTA   31
XP_002942394.2       1   ------------------MAHWAKSSDNRDNVACLDEPGTVQFDTQSLKS   32


NP_619729.1         31   LLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWET   80
XP_001140701.2      49   LLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWET   98
XP_001097884.1      22   ----NPKNSPPLQEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWET   67
XP_848261.1         31   LLPLNPKNGPAVQEKLKSLKAALIILYLLVFVVLIPIIGIMAAQLLKWEM   80
NP_001106711.1      31   LLPPHPKNGPTLQERMKSYKTALITLYLIVFVVLVPIIGIVAAQLLKWET   80
NP_001106797.1      36   SLPHSTKNGPSLQEKLKSFKAALIALYLLVFAVLIPVVGIVTAQLLNWEM   85
NP_001178868.1      32   SLPHNTINGSSVQEKLKSFKVALVALYLLVFAVLIPVVGIVTAQLVNWEM   81
XP_002942394.2      33   LLPSSTAL-TCIQRRLKLFGLALVVLYVIVLSILFLVIG--------FKV   73


NP_619729.1         81   KNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILD   130
XP_001140701.2      99   KNCSVGSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHISD   148
XP_001097884.1      68   KNCSIGSTNADDITQSLTGKGNDSEAETRFQEVFMEHMSNMEKRIQHISD   117
XP_848261.1         81   KNCTVDPIKANDISQSLTGKGNDSEDEMRFQEVVMEQMSNMEKRIQYISD   130
NP_001106711.1      81   KNCTVGSVNA-DISPSPEGKGNGSEDEMRFREAVMERMSNMESRIQYLSD   129
NP_001106797.1      86   KNCLVCSLNTSDTSQGPMEKENTSKVEMRFT-IIMEHMKDMEERIESISN   134
NP_001178868.1      82   KNCLVGSANTSDTSQTLTGKENTSKAEMGFT-IAMERMKALEERVQSISD   130
XP_002942394.2      74   QNSNYEK----DIQELAEKQEGDINAQTTHESATI-----LKQFGQNLSA   114


NP_619729.1        131   MEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSL   180
XP_001140701.2     149   MEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSL   198
XP_001097884.1     118   MEANLIDAEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNTIDEISKSL   167
XP_848261.1        131   TEANLIDSEHFQNFSLVTDQRFNDVLLQLSTLVSSVRGHGNMIDEISKSL   180
NP_001106711.1     130   NEANLLDAKNFQNFSITTDQRFNDVLFQLNSLLSSIQEHENIIGDISKSL   179
NP_001106797.1     135   SKADLIDTERFQNFSMATDQRLNDILLQLNSLISSVQEHGNSLDAISKSL   184
NP_001178868.1     131   SKAGLLDTDRFQNFSMATDQRLNDLLLQLNSLISSVQEHGESLDAISKSL   180
XP_002942394.2     115   FRAELSTNTQ-----------------NLQKLRQNLQDNNLLFNEMQKTV   147


NP_619729.1        181   ISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVYNVSAEIMAMK   230
XP_001140701.2     199   ISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVYNVSAEIMAMK   248
XP_001097884.1     168   ISLNTTLLDLQLNIEKLNGKIQEKTFKQQEEISKLEERVYNVSAEIMAMK   217
XP_848261.1        181   INLNTTLLDLQLNIKTLNDKVQDNTFKQQEDMSRLEERLYNASAEIMSMK   230
NP_001106711.1     180   VGLNTTVLDLQFSIETLNGRVQENAFKQQEEMRKLEERIYNASAEIKSLD   229
NP_001106797.1     185   QSLNMTLLDVQLHTETLNVRVRESTAKQQEDISKLEERVYKVSAEVQSVK   234
NP_001178868.1     181   QSLNTTLLDVQVHTETLNVKVRESTAKQQEDISKLEERVHKVSAEIQSVK   230
XP_002942394.2     148   EQLTATLEELKSKVDYANSTSLENLYMLQEEITQRRSFFHNTSTEIAGVR   197


NP_619729.1        231   EEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE   280
XP_001140701.2     249   EEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE   298
XP_001097884.1     218   EEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE   267
XP_848261.1        231   EKQVNLEQEIKGEVKLLNNITNDLRLKDWEHSQTLKNITLIQGPPGPPGE   280
NP_001106711.1     230   EKQVYLEQEIKGEMKLLNNITNDLRLKDWEHSQTLKNITLLQGPPGPPGE   279
NP_001106797.1     235   EEQAHVEQEVKQEVRVLNNITNDLRLKDWEHSQTLKNITFIQGPPGPQGE   284
NP_001178868.1     231   EEQEHVEQEVKQEVKVLNNITNDLRLKDWEHSQTLKNITLIQGPPGPPGE   280
XP_002942394.2     198   QECMTLEKEMKEEVKTLNKITNDLRLKDWEKAFILNNLTSIQGPPGPKGE   247


NP_619729.1        281   KGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLP---GYAGRPG   327
XP_001140701.2     299   KGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLP---GYAGRP-   344
XP_001097884.1     268   KGDRGPTGESGPRGFPGPVGPPGLKGDRGAIGFPGSRGLP---GYAGRPG   314
XP_848261.1        281   KGDRGPTGESGPRGVPGAIGPPGLKGDRGAIGFPGARGFPGPVGKTGRTG   330
NP_001106711.1     280   KGDRGPPGQNGIPGFPGLIGTPGLKGDRGISGLPGVRGFPGPMGKTGKPG   329
NP_001106797.1     285   KGDRGLTGQTGPPGAPGIRGIPGVKGDRGQIGFPGGRGNPGAPGKPGRSG   334
NP_001178868.1     281   KGDKGLTGQSGPPGVPGARGPPGPKGDQGPVGFPGGRGYPGAPGKAGRSG   330
XP_002942394.2     248   KGDTGVKGDTGVSGFQGIRGFPGSKGEKGQNGYLGSKGAP---------G   288


NP_619729.1        328   NSGPKGQKGEKGSGNTLTPFTK-----VRLVGGSGPHEGRVEILHSGQWG   372
XP_001140701.2     345   -----------------APFTK-----VRLVGGSGPHEGRVEILHSGQWG   372
XP_001097884.1     315   NSGPKGQKGEKGSGNTLTSFKK-----VRLVGGSGPHEGRVEILHSGQWG   359
XP_848261.1        331   NPGPKGQKGDKGSGSMLTPFKT-----VRLVGGKAPHEGRVEIFHNGQWG   375
NP_001106711.1     330   LNGQKGQKGEKGSGSMQRQSNT-----VRLVGGSGPHEGRVEIFHEGQWG   374
NP_001106797.1     335   SPGPKGQKGEKGSVGGSTPLKT-----VRLVGGSGAHEGRVEIFHQGQWG   379
NP_001178868.1     331   FPGPKGQKGEKGRAGISTSLKT-----VRLVDGSGPHEGRVEIFHEGQWG   375
XP_002942394.2     289   IPGLKGQKGEKGEDAATTPSRTTTTPLVRLVGGSSSLLGRVEVFHNGEWG   338


NP_619729.1        373   TICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGR   422
XP_001140701.2     373   TICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGR   422
XP_001097884.1     360   TICDDRWEVRVGQVICRSLGYPGVQAVHKAAHFGQGTGPIWLNEVYCFGR   409
XP_848261.1        376   TVCDDHWELRGGQVICRSLGYQGVQTVHKGAYFGQGTGPIWLNEVFCFGR   425
NP_001106711.1     375   TVCDDRWELRGGLVVCRSLGYKGVQSVHKRAYFGKGTGPIWLNEVFCFGK   424
NP_001106797.1     380   TICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGR   429
NP_001178868.1     376   TICDDRWDIRAGQVVCRSLGYQDVLTVHKRAHFGQGTGPIWLNEVMCFGR   425
XP_002942394.2     339   TVCDDHWGLEDGKVVCKMLGYTGVAQVYVNAYFGQGLARIWMDDVQCNGI   388


NP_619729.1        423   ESSIEECKIRQWGTRACSHSEDAGVTCTL   451
XP_001140701.2     423   ESSIEECKIRQWGTRACSHSEDAGVTCTL   451
XP_001097884.1     410   ESSIEECKIRQWGTRTCSHSEDAGVTCTL   438
XP_848261.1        426   ESSIEECKIRQWGVRVCSHAEDAGVTCTL   454
NP_001106711.1     425   ESSIEECRIRQWGVRACSHDEDAGVTCTT   453
NP_001106797.1     430   ESSIENCKINQWGVLSCSHSEDAGVTCTS   458
NP_001178868.1     426   ESSIENCKISKWGELGCSHAEDAGVTCTS   454
XP_002942394.2     389   EKSIFECKFKGWGITNCRHTEDAGVRCVA   417


Protein Acc. Gene Organism
NP_619729.1 MSR1 H.sapiens
XP_001140701.2 MSR1 P.troglodytes
XP_001097884.1 MSR1 M.mulatta
XP_848261.1 MSR1 C.lupus
NP_001106711.1 MSR1 B.taurus
NP_001106797.1 Msr1 M.musculus
NP_001178868.1 Msr1 R.norvegicus
XP_002942394.2 msr1 X.tropicalis


Support Center