Display Settings:

Format

Send to:

Choose Destination
HomoloGene:121490. Gene conserved in Tetrapoda Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000230.1          1   -MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCL   49
NP_001009073.1       1   -MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCL   49
NP_001095203.1       1   -MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGLDGYRGISLANWVCL   49
XP_531672.1          1   -MKTLLFLGLLLLSITVQGKIFERCELARTLKNLGLAGYKGVSLANWVCL   49
NP_001071627.1       1   -MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLANWMCL   49
NP_059068.1          1   -MKTLLTLGLLLLSVTAQAKVYERCEFARTLKRNGMAGYYGVSLADWVCL   49
NP_038618.1          1   -MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCL   49
NP_036903.2          1   -MKALLVLGFLLLSASVQAKIYERCEFARTLKRNGMSGYYGVSLADWVCL   49
NP_990612.1          1   -MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCV   49
XP_002938553.1       1   MNSAVLFWGGIFIFTVTDGKVFERCELAGIMKKMGLDGYRGYSLPNWVCT   50


NP_000230.1         50   AKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSC   99
NP_001009073.1      50   AKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSC   99
NP_001095203.1      50   AKWESNYNTQATNYNPGDQSTDYGIFQINSHYWCNNGKTPGAVNACHISC   99
XP_531672.1         50   AKWESNYNTRATNYNPGSKSTDYGIFQINSRYWCNDGKTPRAVNACHISC   99
NP_001071627.1      50   ARWESNYNTQATNYNAGDQSTDYGIFQINSHWWCNDGKTPGAVNACHLPC   99
NP_059068.1         50   AQHESNYNTRATNYNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGINC   99
NP_038618.1         50   AQHESNYNTRATNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINC   99
NP_036903.2         50   AQHESNYNTQARNYNPGDQSTDYGIFQINSRYWCNDGKTPRAKNACGIPC   99
NP_990612.1         50   AKFESNFNTQATNRNT-DGSTDYGILQINSRWWCNDGRTPGSRNLCNIPC   98
XP_002938553.1      51   AFFESSFYTDRTNFNRGDNSTDYGILQINSRWWCNDNKTPGSHNACNINC   100


NP_000230.1        100   SALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV-   148
NP_001009073.1     100   SALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV-   148
NP_001095203.1     100   NALLQDNIADAVTCAKRVVSDPQGIRAWVAWRNHCQNRDVSQYVQGCGV-   148
XP_531672.1        100   SALLQDDITQAVACAKRVVSDPNGIRAWVAWRAHCENRDVSQYVRNCGV-   148
NP_001071627.1     100   GALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHCQNQDLTSYIQGCGV-   148
NP_059068.1        100   SALLQDDITAAIQCAKRVVRDPQGIRAWVAWRAHCQNRDLSQYIRNCGV-   148
NP_038618.1        100   SALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQCQNRDLSQYIRNCGV-   148
NP_036903.2        100   SALLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHCKNRDLSGYIRNCGV-   148
NP_990612.1         99   SALLSSDITASVNCAKKIVSDGNGMSAWVAWRNRCKGTDVQAWIRGCRL-   147
XP_002938553.1     101   RALLSDDITQSVICAKRVVRDPQGMEAWVGWRNHCKGRDLSQWIKDCKLD   150


NP_000230.1              ---
NP_001009073.1           ---
NP_001095203.1           ---
XP_531672.1              ---
NP_001071627.1           ---
NP_059068.1              ---
NP_038618.1              ---
NP_036903.2              ---
NP_990612.1              ---
XP_002938553.1     151   ILP   153


Protein Acc. Gene Organism
NP_000230.1 LYZ H.sapiens
NP_001009073.1 LYZ P.troglodytes
NP_001095203.1 LYZ M.mulatta
XP_531672.1 LYZ C.lupus
NP_001071627.1 LYZ B.taurus
NP_059068.1 Lyz2 M.musculus
NP_038618.1 Lyz1 M.musculus
NP_036903.2 Lyz2 R.norvegicus
NP_990612.1 LYZ G.gallus
XP_002938553.1 LOC100492798 X.tropicalis


Support Center