Display Settings:

Format

Send to:

Choose Destination
HomoloGene:11969. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_115715.3          1   -----------------------------------------------MSG   3
NP_001230776.1       1   -----------------------------------------------MSG   3
XP_001091012.1       1   -----------------------------------------------MSG   3
XP_005624609.1       1   -----------------------------------------------MSG   3
NP_001068689.1       1   -----------------------------------------------MSG   3
NP_079835.1          1   -----------------------------------------------MSG   3
XP_003642854.2       1   MGRPGAMRSSHQQRAMAQRERSRREGRAARPEVPCHVAAPGSGGRRAAMS   50
NP_919398.1              --------------------------------------------------
NP_919399.3              --------------------------------------------------
NP_001015996.1           --------------------------------------------------


NP_115715.3          4   EPGQTSVAPPPEEVEPGSG----------VRIVVEYCEPCGFEATYLELA   43
NP_001230776.1       4   EPGQTSVAPPPEEVEPGSG----------VRIVVEYCEPCGFEATYLELA   43
XP_001091012.1       4   EPGQTSVAPPPEEVEPGSG----------VRIMVEYCEPCGFEATYLELA   43
XP_005624609.1       4   EPGPTSEAPPPGEIEPGSG----------VRIVVEYCEPCGFEATYLELA   43
NP_001068689.1       4   DTGTTSVAPPPGETEPGHG----------VRIVVEYCEPCGFEATYLELA   43
NP_079835.1          4   EPAPVSVVPPPGEVEAGSG----------VHIVVEYCKPCGFEATYLELA   43
XP_003642854.2      51   SSGGNGAAAVGTETEAGDGFGSDSGSERRVHIMVEYCPILLWAVVWHGGG   100
NP_919398.1          1   -----------------MG----------VQIKVEYCGGUGYEPRYQELK   23
NP_919399.3          1   -----------------MV----------VKVKIEYCGAUGYEPRFQELK   23
NP_001015996.1       1   -----------------MS----------VSIVVEYCEPCGFKSHYEELA   23


NP_115715.3         44   SAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAI   93
NP_001230776.1      44   SAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAI   93
XP_001091012.1      44   SAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAI   93
XP_005624609.1      44   SAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAI   93
NP_001068689.1      44   SAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAI   93
NP_079835.1         44   SAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLMEAI   93
XP_003642854.2     101   TAYGSLYL----------QGAFEIEINGQLVFSKLENGGFPYEKDLIEAI   140
NP_919398.1         24   RVVTAEFTDADVSGFVGRQGSFEIEINGQLIFSKLETSGFPYEDDIMGVI   73
NP_919399.3         24   REICGNCPDAEVSGFVGRRGCFEIQINDFLVFSKLESGGFPYSEDIIEAV   73
NP_001015996.1      24   SAVLEEFPDVTIDSRPGGTGAFEIEINGQLVFSKLELGGFPYAKDLIEAI   73


NP_115715.3         94   RRASNGETLEKITNSRPPCVIL   115
NP_001230776.1      94   RRASNGEPLEKITNSRPPCVIL   115
XP_001091012.1      94   RRASKGEPLEKITNSRPPCVIL   115
XP_005624609.1      94   RRASNGEPLEKITNSRPPCVIL   115
NP_001068689.1      94   RRASNGEPLEKITNSRPPCVIL   115
NP_079835.1         94   RRASNGEPVEKITNSRPPCVIL   115
XP_003642854.2     141   RRARNGEPLEKITNSRPPCTIL   162
NP_919398.1         74   QRAYDGQPVEKITKSQPPCVIL   95
NP_919399.3         74   VKAKDGKP-EKITRNRKECIIL   94
NP_001015996.1      74   RKASNGEPVEKITNSQAPCVIL   95


Protein Acc. Gene Organism
NP_115715.3 MIEN1 H.sapiens
NP_001230776.1 MIEN1 P.troglodytes
XP_001091012.1 MIEN1 M.mulatta
XP_005624609.1 MIEN1 C.lupus
NP_001068689.1 MIEN1 B.taurus
NP_079835.1 Mien1 M.musculus
XP_003642854.2 MIEN1 G.gallus
NP_919398.1 sepw2a D.rerio
NP_919399.3 sepw2b D.rerio
NP_001015996.1 mien1 X.tropicalis


Support Center