Display Settings:

Format

Send to:

Choose Destination
HomoloGene:115470. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000683.3          1   ---ML--RF---LAPRLLS-----------------------LQGRTARY   19
XP_003951483.1       1   ---ML--RF---LAPRLLS-----------------------LQGRTAHY   19
XP_001114412.1       1   ---ML--RF---LAPRLLC-----------------------LQGRTARY   19
XP_005626900.1       1   ---ML--RFLAPLAPRLLC-----------------------LRGRTAPY   22
XP_005210244.1       1   ---ML--RF---LXPRLFA-----------------------LHHSATQY   19
NP_082546.1          1   ---MLTARL---LLPRLLC-----------------------LQGRTTSY   21
NP_001011975.1       1   ---MLNARF---LVPRLLC-----------------------LQGRTTSY   21
NP_015019.1          1   ---MFSRST-----LCLKTSASS-------------------IGRLQLRY   23
XP_455099.1          1   ---MLLRTTTAGTRLAFKSQTAA-------------------FAH-ALRY   27
NP_564204.1          1   ---MASRRVSSLLSRSFMSSSRSIFS------------LRGMNRGA-QRY   34
NP_001057358.1       1   MAAAAARRGSSLLSRCLLSRPAAAASPAVPSALRRADGTQGLLPGILQRF   50
NP_001048010.1       1   --MAARRAASSLLSRGLIARPSAASSTG-DSAILGAGSARGFLPGSLHRF   47
XP_004910950.1       1   ---MQ--RS---FSHHYIG-----------------------TIWQMGAR   19


NP_000683.3         20   S-------SAAALPSPILNP-DIPYNQ---LFINNEWQDAVSKKTFPTVN   58
XP_003951483.1      20   S-------SAAALPSPILNP-DIPYNQ---LFINNEWQDAVSKKTFPTVN   58
XP_001114412.1      20   S-------SAAALPSPILNP-GISYNQ---LFINNEWQDAVSKKTFPTVN   58
XP_005626900.1      23   S-------SAAALPSPILNP-DIRYNQ---LFINNEWQDAASKKTFPTVN   61
XP_005210244.1      20   F-------SAAALPSPIPNP-DIPDNQ---LFISNKWHDAVSKKTFPTVS   58
NP_082546.1         22   S-------TAAALPNPIPNP-EICYNK---LFINNEWHDAVSKKTFPTVN   60
NP_001011975.1      22   S-------TAAALPNPIPNP-EIRYNQ---LFINNEWHDAVSKKTFPTVN   60
NP_015019.1         24   F-------SHLPMTVPIKLPNGLEYEQPTGLFINNKFVPSKQNKTFEVIN   66
XP_455099.1         28   Y-------SHLPLKVKVDLPNGISYEQPTGLFINNQFVPSKQGKTFEVLS   70
NP_564204.1         35   S------NLAAAVENTITPPVKVEHTQ---LLIGGRFVDAVSGKTFPTLD   75
NP_001057358.1      51   S-------TAAVAEEPISPPVQVNYTQ---LLIDGKFVDSASGKTFPTLD   90
NP_001048010.1      48   SAAPAAAATAAATEEPIQPPVDVKYTK---LLINGNFVDAASGKTFATVD   94
XP_004910950.1      20   F-------STAIIPKPLSNP-EVFYTK---LFINNEWRDAVSGRRFPTVD   58


NP_000683.3         59   PTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRL   108
XP_003951483.1      59   PTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRL   108
XP_001114412.1      59   PTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGQLLNRL   108
XP_005626900.1      62   PTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRL   111
XP_005210244.1      59   PATGEVIGHVAEGDWADVDLAAKAARAAFRLGSPWRWMDALKRGWLLNHL   108
NP_082546.1         61   PTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRL   110
NP_001011975.1      61   PTTGEVIGHVAEGDRADVDLAVRAAREAFRLGSPWRRMDASERGRLLNRL   110
NP_015019.1         67   PSTEEEICHIYEGREDDVEEAVQAADRAFSNG-SWNGIDPIDRGKALYRL   115
XP_455099.1         71   PSTEEEITHVYEGREEDVDAAVEAADKAFKSG-VWSKVDPLVRSQCLSKL   119
NP_564204.1         76   PRNGEVIAQVSEGDAEDVNRAVAAARKAFDEG-PWPKMTAYERSKILFRF   124
NP_001057358.1      91   PRTGELIAHVAEGDAEDINRAVHAARKAFDEG-PWPKMTAYERSRILLRF   139
NP_001048010.1      95   PRTGDVIARVAEGDAEDVNRAVAAARRAFDEG-PWPRMTAYERCRVLLRF   143
XP_004910950.1      59   PCTGEVITHVAEADKADIDAAVKAAREAFKQGSPWRSMDASQRGQLLHRL   108


NP_000683.3        109   ADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHG   158
XP_003951483.1     109   ADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHG   158
XP_001114412.1     109   ADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHG   158
XP_005626900.1     112   ADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHG   161
XP_005210244.1     109   ADLVERDCVYLASLESLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHG   158
NP_082546.1        111   ADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHG   160
NP_001011975.1     111   ADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYLAGWADKWHG   160
NP_015019.1        116   AELIEQDKDVIASIETLDNGKAISSSRG-DVDLVINYLKSSAGFADKIDG   164
XP_455099.1        120   ADYIEKDLDTIASIESLDNGKAISSAKG-DVQLVVNYLRSAAGYADKVDG   168
NP_564204.1        125   ADLIEKHNDEIAALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHG   174
NP_001057358.1     140   ADLIEKHNDEIAALETWDNGKPYAQAANIEVPMVARLMRYYAGWADKIHG   189
NP_001048010.1     144   ADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARYMRYYGGWADKIHG   193
XP_004910950.1     109   ADLIERDKIYLASLETMDNGKPFADSFAIDLSTVVKVYRYYAGFADKVHG   158


NP_000683.3        159   KTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVM   208
XP_003951483.1     159   KTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVM   208
XP_001114412.1     159   KTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVM   208
XP_005626900.1     162   KTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVM   211
XP_005210244.1     159   KTIPMDGEHFCFTRHEPVGVCCQIIPWNFPLVMQSWKLALALAMGNTVVT   208
NP_082546.1        161   KTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVM   210
NP_001011975.1     161   KTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVM   210
NP_015019.1        165   RMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVL   214
XP_455099.1        169   RVIDTGSTHFSYTVREPLGVCGQIIPWNFPLLMWAWKIAPALATGNTVVL   218
NP_564204.1        175   MTMPGDGPHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTVVL   224
NP_001057358.1     190   LVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVL   239
NP_001048010.1     194   LVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNAVVL   243
XP_004910950.1     159   KTIPLDGNYFCYTRHEPVGVCGQIIPWNFPLVMQGWKLGPALATGNTVVM   208


NP_000683.3        209   KVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKV   258
XP_003951483.1     209   KVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKV   258
XP_001114412.1     209   KVAEQTPLSALYVASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKV   258
XP_005626900.1     212   KVAEQTPLSALYLASLIKEAGFPPGVVNVVTGYGPTAGAAIARHMDIDKV   261
XP_005210244.1     209   KVAEQTPFSALYLASLIKEVGLPPGLVNIVTGYGPTAGAAIAHHMDIGKV   258
NP_082546.1        211   KVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKV   260
NP_001011975.1     211   KVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKV   260
NP_015019.1        215   KTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKV   264
XP_455099.1        219   KTAESTPLSALYVSQYIPKAGIPDGVVNIVSGFGKIVGEAITTHPKIKKV   268
NP_564204.1        225   KTAEQTPLSALLVGKLLHEAGLPDGVVNIVSGFGATAGAAIASHMDVDKV   274
NP_001057358.1     240   KTAEQTPLSALFASKLLHEAGLPDGVVNVVSGFGPTAGAALASHMDVDKI   289
NP_001048010.1     244   KTAEQTPLSALFVASLLHEAGLPDGVLNVVSGFGPTAGAALSSHMGVDKL   293
XP_004910950.1     209   KVAEQTPLSALYIASLIKEAGYPPGVVNILTGFGPTAGAALAQHMDVDKI   258


NP_000683.3        259   AFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCH   308
XP_003951483.1     259   AFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCH   308
XP_001114412.1     259   AFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCH   308
XP_005626900.1     262   AFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSVVLADADMEHAVAQCH   311
XP_005210244.1     259   AFTGSTKVGHLIQKAAGNSSLKRVTLELGGKSLSIVLADADMDHAVEQRQ   308
NP_082546.1        261   AFTGSTEVGHLIQKAAGESNLKRVTLELGGKSPSIVLADADMEHAVDQCH   310
NP_001011975.1     261   AFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMDHAVDQCH   310
NP_015019.1        265   AFTGSTATGRHIYQSAA-AGLKKVTLELGGKSPNIVFADAELKKAVQNII   313
XP_455099.1        269   AFTGSTATGRHIYQNAG-VNLKKVTLELGGKSPNVVFADANLKSAVQNSL   317
NP_564204.1        275   AFTGSTDVGKIILELASKSNLKAVTLELGGKSPFIVCEDADVDQAVELAH   324
NP_001057358.1     290   AFTGSTDTGKVVLELAARSNLKSVTLELGGKSPFIIMDDADVDHAVELAH   339
NP_001048010.1     294   AFTGSTGTGKIVLELAARSNLKPVTLELGGKSPFIVMDDADVDQAVELAH   343
XP_004910950.1     259   AFTGSTEVGRLIQKAAGSTNLKRVTLELGGKSPCIVMADADLEQAVEQCH   308


NP_000683.3        309   EALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQ   358
XP_003951483.1     309   EALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQ   358
XP_001114412.1     309   EALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQ   358
XP_005626900.1     312   EALFFNMGQCCCAGSRTFVQESIYDEFLERTVEKAKQRRVGNPFELDTQQ   361
XP_005210244.1     309   EALFFNMGQCCCPGSWTFIEESIYDEFLERTVEKAKQRRVGNPFDLDTQQ   358
NP_082546.1        311   EALFFNMGQCCCAGSRTFVEESIYREFLERTVEKAKQRKVGNPFELDTQQ   360
NP_001011975.1     311   EALFFNMGQCCCAGSRTFVEESIYHEFLERTVEKAKKRKVGNPFELDTQQ   360
NP_015019.1        314   LGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDESTFQ   363
XP_455099.1        318   LGIYYNSGEVCCAGSRLYVEESIYDDFLKEIKSASEALKVGDPFDAETFQ   367
NP_564204.1        325   FALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNVGDPFKSGIEQ   374
NP_001057358.1     340   FALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRVVGDPFKNGVEQ   389
NP_001048010.1     344   RALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRVVGDPFRTGVEQ   393
XP_004910950.1     309   EALFFNMGQCCAAGSRTFVEENVYDEFLERTVEKAKLRKVGNPFDLDTKH   358


NP_000683.3        359   GPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQD   408
XP_003951483.1     359   GPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQD   408
XP_001114412.1     359   GPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQD   408
XP_005626900.1     362   GPQVDKEQFERILNYIRLGQKEGAKLLCGGERFGDRGFFIKPTVFGDVQD   411
XP_005210244.1     359   GPQVDRERFERILGYIQLGQKEGAKLLCGGEHFRQQCFFIKPTVFGGVQD   408
NP_082546.1        361   GPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFFIKPTVFGDVQD   410
NP_001011975.1     361   GPQVDKEQFEKILGYIRLGQKEGAKLLCGGERFGERGFFIKPTVFGNVQD   410
NP_015019.1        364   GAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKE   413
XP_455099.1        368   GAQTSQNQLDKILKYVEIGKNEGATLITGGERIGDKGYFVRPTIFADVEE   417
NP_564204.1        375   GPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKD   424
NP_001057358.1     390   GPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQD   439
NP_001048010.1     394   GPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVED   443
XP_004910950.1     359   GPQINKEQFDKILGYIKSGKTEGAKLMCGGERYGDKGFFIKPTVFANVQD   408


NP_000683.3        409   DMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMY   458
XP_003951483.1     409   DMRIAKEEIFGPVQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMY   458
XP_001114412.1     409   DMRIAKEEIFGPVQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMY   458
XP_005626900.1     412   DMKIAREEIFGPVQPLFKFKKIEEVIERANNTRYGLAAAVFTQDLDKAMY   461
XP_005210244.1     409   DMRIAREEIFGPVQPLFKFKKIEEVIERADNTRYGLAAAVFTQDLDKAMY   458
NP_082546.1        411   GMRIAKEEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKAIY   460
NP_001011975.1     411   DMRIAREEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKALY   460
NP_015019.1        414   DMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALK   463
XP_455099.1        418   SMRIVKEEIFGPVVTVTKFKTIDELIEKANDSEYGLAAGIHTSNINTAIQ   467
NP_564204.1        425   DMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHR   474
NP_001057358.1     440   NMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANT   489
NP_001048010.1     444   EMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANT   493
XP_004910950.1     409   NMKIAREEIFGPVQPVFKFKSIKEVIERANNTSYGLAAGIFTRDLDKAML   458


NP_000683.3        459   FTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTV   508
XP_003951483.1     459   FTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTV   508
XP_001114412.1     459   FTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTV   508
XP_005626900.1     462   FTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTV   511
XP_005210244.1     459   FTQALQTGTVWVNTYNVVTCHTPLGGFKEPGNGRELGEDGLKAYTEVKTV   508
NP_082546.1        461   FTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLRAYTEVKTV   510
NP_001011975.1     461   FSQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTV   510
NP_015019.1        464   VADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMSVDALQNYLQVKAV   513
XP_455099.1        468   VSNRLNAGTVWINTYNDFHHCVPFGGFNASGIGREMGSEALDNYTQVKAV   517
NP_564204.1        475   LMRALRVGTVWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAV   524
NP_001057358.1     490   LTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAV   539
NP_001048010.1     494   LARALRVGTVWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAV   543
XP_004910950.1     459   LTQALRAGTVWVNTYNIVTCQTPFGGFKESGNGRELGEDGLKAYTEVKTV   508


NP_000683.3        509   TIKVPQKNS-   517
XP_003951483.1     509   TIKVPQKNS-   517
XP_001114412.1     509   TIKVLQKNS-   517
XP_005626900.1     512   TIKIPQKNS-   520
XP_005210244.1     509   TIKVPQKNS-   517
NP_082546.1        511   TIKVPEKNS-   519
NP_001011975.1     511   TIKVSEKNS-   519
NP_015019.1        514   RAKLDE----   519
XP_455099.1        518   RVKLE-----   522
NP_564204.1        525   VTSLKNPAWL   534
NP_001057358.1     540   VTPIKNAAWL   549
NP_001048010.1     544   VTPIKDAAWL   553
XP_004910950.1     509   TMKISHKKS-   517


Protein Acc. Gene Organism
NP_000683.3 ALDH1B1 H.sapiens
XP_003951483.1 ALDH1B1 P.troglodytes
XP_001114412.1 ALDH1B1 M.mulatta
XP_005626900.1 ALDH1B1 C.lupus
XP_005210244.1 ALDH1B1 B.taurus
NP_082546.1 Aldh1b1 M.musculus
NP_001011975.1 Aldh1b1 R.norvegicus
NP_015019.1 ALD4 S.cerevisiae
XP_455099.1 KLLA0F00440g K.lactis
NP_564204.1 ALDH2B7 A.thaliana
NP_001057358.1 Os06g0270900 O.sativa
NP_001048010.1 Os02g0730000 O.sativa
XP_004910950.1 aldh1b1 X.tropicalis


Support Center