Display Settings:

Format

Send to:

Choose Destination
HomoloGene:1153. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001136269.1       1   ----MELRKYGPGRLAGTVIGGAAQSKSQTKSDSITKEFLPGLYTAPSSP   46
XP_001137964.1       1   ----MELRKYGPGRLAGTVIGGAAQSKSQTKSDSITKEFLPGLYTAPSSP   46
NP_001138512.1       1   ----MVL-------------------------------------------   3
NP_001011887.1       1   ----MVP-------------------------------------------   3
NP_001011673.1       1   ----MVP-------------------------------------------   3
NP_034040.1          1   ----MYL-------------------------------------------   3
NP_445867.1          1   ----MYL-------------------------------------------   3
NP_001082899.2           --------------------------------------------------
XP_002938579.2       1   MSKNIMLLKLQDCILFTIKKQMFASGNDTLATYRGETSEPLQIRSETEDL   50


NP_001136269.1      47   FPPSQVSDHQVLNDAEVAALLENFSSSYDY-GENESDSCCTSPPCPQDFS   95
XP_001137964.1      47   FPPSQVSDHQVLNDAEVAALLENFSSSYDY-GENESDSCCTSPPCPQDFS   95
NP_001138512.1       4   ----EVSDHQVLNDAEVAALLENFSSSYDY-GENESDSCCTSPPCPQDFS   48
NP_001011887.1       4   ----EMSERQVFQASELTYLLENCSSSYDY-AENESDSCCASPPCPQDIS   48
NP_001011673.1       4   ----EMSERQEFQASDFAYLLEN--SSYDY-GENETYFCCTSPPCPQDFS   46
NP_034040.1          4   ----EVSERQVLDASDFAFLLENSTSPYDY-GENESDF-SDSPPCPQDFS   47
NP_445867.1          4   ----EVSERQVLDASDIAFLLENSTSPYDY-GENESDF-SDSPPCPQDFS   47
NP_001082899.2       1   ---MNVDSKTTFSMKDFS----DYTDLYNYSDYNDNESYGAGAVCTQDSS   43
XP_002938579.2      51   LANMANSGHGIYDDLDV-----ETSSIFNY-DYSTSSESNDVAPCDLQTT   94


NP_001136269.1      96   LNFDRAFLPALYSLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVA   145
XP_001137964.1      96   LNFDRAFLPALYSLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVA   145
NP_001138512.1      49   LNFDRAFLPALYSLLFLLGLLGNGAVAAVLLSRRAALSSTDTFLLHLAVA   98
NP_001011887.1      49   LNFDRAFLPALYGLLFLLGLLGNGAVAAVLCSQRAARTSTDTFLLHLAVA   98
NP_001011673.1      47   LNFDRTFLPVLYSLLFVLGLLGNGIVAVVLLSQRAALSSTDTFLLHLAVA   96
NP_034040.1         48   LNFDRTFLPALYSLLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVA   97
NP_445867.1         48   LNFDRTFLPVLYSLLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVA   97
NP_001082899.2      44   MYFDSIFKPILYSLAAVVGLLGNGLVLIVLWKKRAGLNVTDIFILHLSLA   93
XP_002938579.2      95   IIFDRSFLPAFYSILFLLGILGNVLVMVVLLQNRKRLQSTDIFLLHLALA   144


NP_001136269.1     146   DTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFD   195
XP_001137964.1     146   DTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFD   195
NP_001138512.1      99   DTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFD   148
NP_001011887.1      99   DMLLVLTLPLWRVDTAVQWVFGSGLCKVAGALFNINFYAGALLLACISFD   148
NP_001011673.1      97   DALLVLTLPLWAVDAAIQWVFGSGLCKVAGALFNINFYAGALLLACISFD   146
NP_034040.1         98   DVLLVLTLPLWAVDAAVQWVFGPGLCKVAGALFNINFYAGAFLLACISFD   147
NP_445867.1         98   DVLLVLTLPLWAVDAAAQWVFGSGLCKVAGALFNINFYAGAFLLACISFD   147
NP_001082899.2      94   DILLLLTLPFWAVEAVKEWIFGTPLCKLTGAMFRINFYCGIYMLSCISLD   143
XP_002938579.2     145   DILLVVTLPFWATQAVSGWLFGNVLCKTVASIFKINFYACTFLLVCISCD   194


NP_001136269.1     196   RYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDE-R   244
XP_001137964.1     196   RYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDE-R   244
NP_001138512.1     149   RYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDE-R   197
NP_001011887.1     149   RYLSIVHATQPYRRGPPARVTLTCVVVWGLCLFFAIPDFIFLSANRDE-R   197
NP_001011673.1     147   RYLSIVHATQLYRRGPPTRVALTCVAVWGLCLLFALPDFIFLSSHHDN-R   195
NP_034040.1        148   RYLSIVHATQIYRRDPRVRVALTCIVVWGLCLLFALPDFIYLSANYDQ-R   196
NP_445867.1        148   RYLSIVHATQIYRRDPWVRVALTCIVVWGLCVLFALPDFIFLSASHDQ-R   196
NP_001082899.2     144   RYLSIVHAVQMYSRKKPMAVHCCCMIVWFFCFLLSIPDWILLGANKDSRR   193
XP_002938579.2     195   RYLAIVYAVQVYKKHRTNLVHWSCLFVWCLCVGLSVPDMVHFQVAYEP-R   243


NP_001136269.1     245   LNATHCQYNFPQVG----RTALRVLQLVAGFLLPLLVMAYCYAHI-LAVL   289
XP_001137964.1     245   LNATHCQYNFPQVG----RTALRVLQLVAGFLLPLLVMAYCYAHI-LAVL   289
NP_001138512.1     198   LNATHCQYNFPQVG----RTALRVLQLVAGFLLPLLVMAYCYAHI-LAVL   242
NP_001011887.1     198   LNAMHCRYNFPQVG----RTALRGLQLVAGFLLPLLVMAYCYARI-LAVL   242
NP_001011673.1     196   LNATHCQYNFPQEG----HTALRILQLVAGFLLPLLVMAYCYARI-LAVL   240
NP_034040.1        197   LNATHCQYNFPQVG----RTALRVLQLVAGFLLPLLVMAYCYAHI-LAVL   241
NP_445867.1        197   LNATHCQYNFPQVG----RTALRVLQLVAGFLMPLLVMAYCYAHI-LAVL   241
NP_001082899.2     194   QDRTECVNSEALSD--FWVLVNRLIYHFLGFIIPAIMMVFCYTSILLRLL   241
XP_002938579.2     244   TNVTECQPVFGSSNFKTWRVSMAFLYHIVGFLLPLCFMLYCYTHI-IHTL   292


NP_001136269.1     290   LVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDIL--MDLGALARNC   337
XP_001137964.1     290   LVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDIL--MDLGALARNC   337
NP_001138512.1     243   LVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDIL--MDLGALARNC   290
NP_001011887.1     243   LVSRGQRRQRRMRLVVVVVVAFALCWTPYHLVVLVDTL--MDLGALDRNC   290
NP_001011673.1     241   LVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDTL--MDLGALARNC   288
NP_034040.1        242   LVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDIL--MDVGVLARNC   289
NP_445867.1        242   LVSRGQRRFRAMRLVVVVVVAFAVCWTPYHLVVLVDIL--MDVGVLARNC   289
NP_001082899.2     242   LGSKCMQKKRAIHVIVALVLAFFISWTPYNIALMADTIHTNRTDNNQTSC   291
XP_002938579.2     293   FQTHGFKKQRALRVIITVVVAFFLCWTPYNIVALLDTL--NLLHVLADNC   340


NP_001136269.1     338   GRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLG--C   385
XP_001137964.1     338   GRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLG--C   385
NP_001138512.1     291   GRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLG--C   338
NP_001011887.1     291   GRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLG--C   338
NP_001011673.1     289   GRESSVDIAKSVTSGMGYMHCCLNPLLYAFVGVKFRERMWVLLVRLG--C   336
NP_034040.1        290   GRESHVDVAKSVTSGMGYMHCCLNPLLYAFVGVKFREQMWMLFTRLG--R   337
NP_445867.1        290   GRESHVDVAKSVTSGMGYMHCCLNPLLYAFVGVKFKEQMWMLLMRLG--R   337
NP_001082899.2     292   ETRTTLDVAITATSTFAYMHCCVNPILYAFVGVKFRQHLLDMLRPLG---   338
XP_002938579.2     341   TIDSNIDIALSVTSGLCYFHSCLNPLLYAFVGAKFKKKLVELLSKLSCIC   390


NP_001136269.1     386   PNQRGLQRQPSSSRRDSSWSETSEASYSGL-   415
XP_001137964.1     386   PNQRGLQRQPSSSRRDSSWSETSEASYSGL-   415
NP_001138512.1     339   PNQRGLQRQPSSSRRDSSWSETSEASYSGL-   368
NP_001011887.1     339   PDHRGHQRHPTLSRRESSWSETPSTPR----   365
NP_001011673.1     337   PDQRCHQRQPSASRRESSWSETTEASYSGL-   366
NP_034040.1        338   SDQRGPQRQPSSSRRESSWSETTEASYLGL-   367
NP_445867.1        338   SDQRGPQRQPSSSRRESSWSETTEASYLGL-   367
NP_001082899.2     339   --FKLKGRAGLVSRKSSGWSESVDTSHTSAF   367
XP_002938579.2     391   PQIVKNYIKHSPSAKSSTWSESGETSISRM-   420


Protein Acc. Gene Organism
NP_001136269.1 CXCR3 H.sapiens
XP_001137964.1 CXCR3 P.troglodytes
NP_001138512.1 CXCR3 M.mulatta
NP_001011887.1 CXCR3 C.lupus
NP_001011673.1 CXCR3 B.taurus
NP_034040.1 Cxcr3 M.musculus
NP_445867.1 Cxcr3 R.norvegicus
NP_001082899.2 cxcr3.1 D.rerio
XP_002938579.2 LOC100485636 X.tropicalis


Support Center