Display Settings:

Format

Send to:

Choose Destination
HomoloGene:11457. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_076996.2          1   ------------MALITLRK-NLYRLSDFQM-----HRALAALKNK--PL   30
XP_517625.3          1   ------------MALITLRK-NLYRVSDFQM-----HRALAALKNQ--PL   30
XP_545176.4          1   ------------MALITLRR-NLCHLSDFRI-----HGALAALRNH--PV   30
NP_001019699.2       1   ------------MALVTLRR-NLYHLSDFRI-----HGALAALKTQ--QV   30
NP_081399.3          1   ------------MAFITLRR-AFCHKSILWI-----PGAVVALKIH--PA   30
NP_001076043.1       1   ------------MAF-TLRR-AFCHMSVFWM-----PGAVVALKIH--PA   29
XP_419017.3          1   ------------MALITLKSFHFCSPGAPAS-----RRVLLTLCKSLSSA   33
XP_001338251.1       1   ----------------MVTLFPMAKTLALRL------RVLSLLDYQILKA   28
NP_001135619.2       1   MRRVPNVSAGSTSLYFSMAIMNICGSHSTVSLIINAYRRAANLSIHFSCI   50


NP_076996.2         31   NHVHKVVKERLCPWLCSRQPEPFGV--KFHHAHCKKFHSKNGND-LHPLG   77
XP_517625.3         31   NHVHKVVKERLCPWLCSRQPEPFGV--RFHHAHCKKFHSKNGND-LHPLG   77
XP_545176.4         31   SRVHKIAEERRPPWFCPLPSEPVRV--RFHHACGQKFHSENGNDLLHPAG   78
NP_001019699.2      31   NHVHKTVKEHLCPWFWSQHPGPIRV--RFHHAHCKKFHSENGND-LHPVG   77
NP_081399.3         31   SHAPKAVTDRLSVCFCSLQPELFRV--RFHHAYCKNFHSEKGND-FHPVG   77
NP_001076043.1      30   NNVQKAVRDCLRVWFCSLQPDLFRV--RFYHAYCKSFHSENGND-LHPVG   76
XP_419017.3         34   GERRK-----PQS-YSPTAVRVLCSKDKCRDVFCWKNHVQLRMQSLS-VN   76
XP_001338251.1      29   CAGKPLSSPFLQTYTGCFPTCSFHS--------ARAVCTTERDPLFLASG   70
NP_001135619.2      51   KRSKRFVHNLPCSYYTPKKAYIFSY------LFCRKYYSVILNPPYSIVG   94


NP_076996.2         78   GPVFSQ----VSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFISTME   123
XP_517625.3         78   GPVFFQ----VSDCDRLEQNVKNEESQMFYKRLSNLTSSEEVLSFISTME   123
XP_545176.4         79   ELVFPP----AHDWDTPEQNPSRVDEQTFYERLNHLTSSEEVLSFVSTLQ   124
NP_001019699.2      78   EPGFSQ----VHNWDRFEHSVKNVDEQMFYRKLNSFTSSGEILRFVSTLE   123
NP_081399.3         78   EPWSSQ----AQEWNQPGQSLQNEDEEMLFRRLSYFTSFEEVLSFISALD   123
NP_001076043.1      77   EPWFSQ----AQVWNQPEQTLKNEDEEMLSRRLNSFASFEEVLSFIHTLD   122
XP_419017.3         77   ETVHLC----GDTGSSTQARERWMDEQVFFRTLKSLHTSQEIFKFLRCLE   122
XP_001338251.1      71   SVRPYQELCLSGSGLSLMHYLSSNEDHAFMKRLSSCSTSQQVLHLLRSYS   120
NP_001135619.2      95   CSVHHH----GDSGTTYTISKQQANENKFLSDLCYAHSCTQVFKLLSSLE   140


NP_076996.2        124   TLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEPSQL   173
XP_517625.3        124   TLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEPSQL   173
XP_545176.4        125   ALPDTLAAGALQRICDMERKDGDQKLPKEILKNSVFQALCVQLERESSSL   174
NP_001019699.2     124   TLPDTMMAGALHRICEVERKDGDQRLPKEILESSAFQALCDRFGRDPSDL   173
NP_081399.3        124   TLPVPLAMAALLRICEIGRRDGEQRLPEGVLENRAFQALCLRCERDPSHL   173
NP_001076043.1     123   TLPVTLASAALLRICEIGKRDDEQRLPKEVLENRVFQALCLRCERDPSHL   172
XP_419017.3        123   VMSDIMASGALQRICEVEVDGDGLKNPEDVLENEVFRALCFQFEFESSKL   172
XP_001338251.1     121   VLSSAVAASILHRLADLEHDAPEKSWS--YLSDVAFNKLCQRLEDNSAEL   168
NP_001135619.2     141   VFTDTMAAAALLKVAQVETKDGILTNPRKVFDNMIFKAICLQFEQESKNL   190


NP_076996.2        174   SNTSLVTALQALIL-LHVDPQSSLLLNLVAECQNRLRKGGMEVRNLCILG   222
XP_517625.3        174   SNTSLVTALQALIL-LHVDPQSSLLLNLVAECQNRLRKGGMEVRNLCILG   222
XP_545176.4        175   PDPVLVTALQALTL-LHADPQSSLLLNLVAECQRRLQRGGLEVHSLCILG   223
NP_001019699.2     174   SNAGLVTAFQALTL-LCGDPQSHLLMNLEAECQHRLERGGLDVHSLCILG   222
NP_081399.3        174   TNAGLVTALQSLLTLLPADPQSSLMLSLVAECQRRLQRGNLEVHHLCVLG   223
NP_001076043.1     173   TNAVLVTVLQSLVI----DPQSSLVLSLVAECQRRLRRGSLEVHHLCVLG   218
XP_419017.3        173   SNTGLLNALQALIR-LRIDPHSTLIASLLSECEERLANRKLTVDSLCSLG   221
XP_001338251.1     169   ENEVLVGALLSCTR-LYLGSRSSLVLRLVLECQKRLDSEKLNVKVLCGIS   217
NP_001135619.2     191   STAGIVNALKAFVQ-LRVDPWSNLMVRLLSESQERAEKGEMNIQYLCMLG   239


NP_076996.2        223   ESLITLHSSGCVTLELIINQLQGEKLETFTPEDIVALYRILQACTEKVDE   272
XP_517625.3        223   ESLITLHSSGCVTLELIINQLQGEKLETFTPEDIVALYRILQACTEKVDE   272
XP_545176.4        224   ESLIKLQGPGCATLELIICQLQGEKLEEFTPEDIVTLYRILQACTVKVNQ   273
NP_001019699.2     223   ETLIKLHGPGCSTLDLIIYQLQGESLETFTPEDIVTVYRLLQASPEKADQ   272
NP_081399.3        224   ESLAMLQGASCETLKLVVRQLQSKSVETFAPEEITSVYRILQVCPEEVDK   273
NP_001076043.1     219   ESLARLQGASCEILKLVICQLQSENLETFAPEDIVSVYRILQACPEEVDK   268
XP_419017.3        222   ESLLELEVPSCAMLEQIVSHMQEKDIENWSPREMAMVYKILQVVVGEREQ   271
XP_001338251.1     218   RASFALEGHDSGLVKQAMSQLQKTETAQWKAAELVAVYCMLATGLAEDVL   267
NP_001135619.2     240   RCLLEIEGPECAMLKPVMDQVLQKKINDWTPEEIAMVYGLLQAGLGEKGQ   289


NP_076996.2        273   HQTFLNKINNFSLSIVSNLSPKLISQMLTALVVLDQSQAFPLIIKLGKYV   322
XP_517625.3        273   HQTFLNKINNFSLSIVSNLSPKLISQMLTALVFLDQSQAFPLIIKLGKYV   322
XP_545176.4        274   HQAFLNRINTFSLSVVYSLSPALMSQMLGALVVLDQTQALPLFIKLGKSV   323
NP_001019699.2     273   QQRFLNKINHFSLSLVSNLSPKLMSQMLTALVVLDQTQALPLVIKLSKYV   322
NP_081399.3        274   HQMFLNTLNNFSISVVPYLSPKSISHVLTALVALDQTHALPLLIKLGKYV   323
NP_001076043.1     269   HQTFLNTVNNFSLSIVSYLSPKSISHVLTALVALDQTHARPLLIKLGKSV   318
XP_419017.3        272   YRDLLNRMNSATLTIAYQLCPKFTSAILNSLVALHQTQVVPLILALCKHS   321
XP_001338251.1     268   YQDLLNEMNAQALRLVHQMDPEAVSKILGALVTLRQEQALPLVIALCKQA   317
NP_001135619.2     290   YQGLLNQMHEATVSKASQMNPTLISSILTALVDLKQTQALPLVINLCKNS   339


NP_076996.2        323   VRHVPHFTNEELRRVLEAFIYFGHHDTFFTKALEHRVAAVCLTLDPEVVC   372
XP_517625.3        323   VRHVPHFTNEELRRVLEAFIYFGHHDTFFTKALEHRVAAVCLTLDPEVVC   372
XP_545176.4        324   VKHIPHFTNEELRKVLEAFIYFGHNDRFFTKALEQHVASACLTLGPDVVS   373
NP_001019699.2     323   VRHIARFTSEELRKVLEALIYFGHSDRFFTETLEQHVASLCLTLDPELVS   372
NP_081399.3        324   VRYIPRFTNEELRKVLEAFVYFGHSDRFFTEALEQHVSALCFSLDPAVAS   373
NP_001076043.1     319   VRYIPRFTNEELRQVLEAFVYFGHSDRFFTEALEQHVAAQCFSLDPAVAS   368
XP_419017.3        322   VKHVPYFTSDELASVLEAFLFFGHREQIFTEALEKHVPKSIPTMPPETVS   371
XP_001338251.1     318   VHQVQSFADAELTVVLSALMHFGHSDHFFVEALERYVPKVAFTAHAETIT   367
NP_001135619.2     340   IRCMPHFTDEELVNVIVALTNFGHSDKYFTEALERHVPRMVFTMSPELVS   389


NP_076996.2        373   RVMEYCSRELILSKPILNAVAETFVCQTEKFSPRQISALMEPFGKLNYLP   422
XP_517625.3        373   RVMEYCSRELILSKPILNAVAETFVCQTEKFSPRQISALMEPFGKLNYLP   422
XP_545176.4        374   KVMEYCSRKRILSKPILDAVAETFICQSEKFSPHQISELIEPFGKLNYLP   423
NP_001019699.2     373   RVMEYCSRKLILSEPIFNAVAETFVCQAEKFSPSQTAKLIEPFGKLNYLP   422
NP_081399.3        374   SVMGYCSRKRILSKPIFDVVSEIVVCQWDRLSPSQIAELIEPFGKLNYVP   423
NP_001076043.1     369   SVMEYCSRKRILSKPIFDVVAEIFVCQSEKFSPSQISELIEPFGKLNYLP   418
XP_419017.3        372   KVMRYCCQKKILSKPILDAVAEGFISNADSFTTDQIAEYIVPFGTLNYLP   421
XP_001338251.1     368   KVMQFFQHRRILSLPVFNAVAESFVYRAEEYSTWQVSQQITTLGVLGYLP   417
NP_001135619.2     390   RVMEYCSKRLILSKPIFDAVAESFVYNSENCTTLQIAQQIIPFGELNYLP   439


NP_076996.2        423   PNASALFRKLENVLFTHFNYFPPKSLLKLLHSCSLNECHPVNFLAKIFKP   472
XP_517625.3        423   PNASALFRKLENVLFTHFNYFPPKSLLKLLHSCSLNECHPVNFLAKIFKP   472
XP_545176.4        424   PNASTLFRKLENMLLTHFHYFPPKTLLKILHSCSLIECHPVNFMAKIFSP   473
NP_001019699.2     423   PNASALFRKLENMLLTRFNHFPPKTLLRLLHSCSLIESHPVNFMAKIFSP   472
NP_081399.3        424   PNAPALFRKVENVLCARLHHFPPKMLLRLLHSCALIERHPVNFMSKLFSP   473
NP_001076043.1     419   PNAPALFRKVENVLFAHLRHFPPKMLLRLLHSCSLIERHPVNFMSKIFSP   468
XP_419017.3        422   PNASSLFRKLEAILHTRLGQFQPHALLNLLHSCVLIQRYPVNFLPKIFSP   471
XP_001338251.1     418   PDAGRLFRKVESVLHARFSQFQPRALLDLLHACTLLQRYPLNFVSKVFSS   467
NP_001135619.2     440   PNAASMFRRLEKILSSRFSQFQPQILLKLLHSCILLERFPVNFVAKIFSP   489


NP_076996.2        473   LFLQRLQGKESH--------------LDTLSRAQLTQLFLASVLECPFYK   508
XP_517625.3        473   LFLQRLQGKESH--------------LDTLSRAQLTQLFLASVLECPFYK   508
XP_545176.4        474   HFLQKLQGEELY--------------LDRLSLAQLTQLFLTSVLECPFYK   509
NP_001019699.2     473   YFLQQLQGAESY--------------LDRLSLAQLTQLFLTSILECPFYK   508
NP_081399.3        474   FFLQRLQGKESY--------------LDRLSLAQLTQLFLTSVLECPFYK   509
NP_001076043.1     469   FFLQRLQGKESY--------------LDRLSLAQMTQLFLTSVLECPFYK   504
XP_419017.3        472   YFLQELQAQPPG--------------LDRVVASQLTQLFLTVTLECPFYE   507
XP_001338251.1     468   YFLQLLQGEEGSG-------------LSHVVLAQLTQLYMSVKLECPFYD   504
NP_001135619.2     490   YFIQQLQDNAVGGHSDRYTSKDQSGNVDKFVLALLTQLFLTVSLECPFYE   539


NP_076996.2        509   GPKLLPKYQVKSFLTPCCSLETPVDSQLYRYVKIGLTNLLGARLYFAPKV   558
XP_517625.3        509   GPKLLPKYQVKSFLTPCCSLETPVDSQLYRYVKIGLTNLLGARLYFAPKV   558
XP_545176.4        510   GQKLLSKYQVRSFLTPCCSLETPVDFQLFRSVKTGLIDLLGARLYFASKV   559
NP_001019699.2     509   GPKLLPKFQVKSFLTPCSSLETPMDFHLYKSVMIGLIDLLGARLYFSSKV   558
NP_081399.3        510   GPKLLPKYQVKSFLTPCCSLETPLDLHLYKSVVIGLIDLLGSRLYFASKV   559
NP_001076043.1     505   GPKLLPKYQVKSFLTPCCSLETPMDLHLYKSVVIGLIDLLGSRLYFASKV   554
XP_419017.3        508   GPKLLPKYQVNAFLTT----HCFLDVHLFRKVKSGLLHLLKKGMYFSSEV   553
XP_001338251.1     505   GPRLLPKFCVKSFLAP---FETPVEPQFYNALKSGLVDLLGDQSIVASRV   551
NP_001135619.2     540   GPRLLPKYRVKSFSASGQSLETMVDVHLYNRVKSGLIDLLGARMYFASHV   589


NP_076996.2        559   LTPYCYTIDVEIKLDEEGFVLPSTANEDIHKRIALCIDGPKRFCSNSKHL   608
XP_517625.3        559   LTPYCYTIDVEIKLDEEGFVLPSTANEDIHKRIALCIDGPKRFCSNSKHL   608
XP_545176.4        560   LTPYCYTIDVEIKLDEEGLVLPSAVHEDVHKRVALCIDDPKRFSLNSKHL   609
NP_001019699.2     559   LTPYCYTIDVEIKLDEDGFVLPFTIDEDVHKRVALCIDGPKRFCLNSKHL   608
NP_081399.3        560   LTPYYYTIDVEVKLDEDGFVLPCTVDEDIHKRVALCIDGPQRFCLDSKHL   609
NP_001076043.1     555   LTPYYYTIDVEIKLDEDGFVLPFTVDEDVHTRVALCIDGPQRFCLGSKHL   604
XP_419017.3        554   STPYFYTVDIEIKLDEEGFMLPATQCEEVHTRIALCVDGQNRFCVNSHNL   603
XP_001338251.1     552   LTPYCYTLDIEIKLDEDGFVLPACHADDVHKRIAVCIDGSQRFAANAKKL   601
NP_001135619.2     590   LSPYCYTLDVEIKLDEEGFVLAASSHEEVHRRIALCIDGQKRFCSNTHKL   639


NP_076996.2        609   LGKEAIKQRHLQLLGYQVVQIPYHEIGMLKSRRELVEYLQRKLFSQNT-V   657
XP_517625.3        609   LGKEAIKQRHLQLLGYQVVQIPYHEIGMLKSRRELVEYLQRKLFSQNT-V   657
XP_545176.4        610   LGKEAIKQRHLRLLGYQVVQIPYYEIEVLKSRGELVEYLQRKLFPQSTGV   659
NP_001019699.2     609   LGKEATKQRHLRLLGYQVVQIPYYEIEMLKSRLELVDYLQGKLFSQNSGG   658
NP_081399.3        610   LGKEATKQRHLRLLGYQVVQLPYHELELLTSRLELVDYLQRKLFSQSSAV   659
NP_001076043.1     605   LGKEAIKQRHLRLLGYQVVQVPYHELELLTSRLELVDYLQRKLFSQSSTV   654
XP_419017.3        604   LGEEAIKQRHLQLLGYKVVQVPFFEVESIKSCRKMAEYLHRKIFPHTYGH   653
XP_001338251.1     602   LGKEAMKQRHLRILGYEVVQIPYYEFEKLKKKKEVVEYLHKKIFPHSYRL   651
NP_001135619.2     640   LGKESIKQRHLRLLGYEVIQIPFYEFDNLSYKEEIVEYLHKKIFPHTYRL   689


NP_076996.2        658   HWLQE   662
XP_517625.3        658   HWLQE   662
XP_545176.4        660   CW---   661
NP_001019699.2     659   HW---   660
NP_081399.3        660   HW---   661
NP_001076043.1     655   HW---   656
XP_419017.3        654   GC---   655
XP_001338251.1     652   SW---   653
NP_001135619.2     690   NW---   691


Protein Acc. Gene Organism
NP_076996.2 FASTKD3 H.sapiens
XP_517625.3 FASTKD3 P.troglodytes
XP_545176.4 FASTKD3 C.lupus
NP_001019699.2 FASTKD3 B.taurus
NP_081399.3 Fastkd3 M.musculus
NP_001076043.1 Fastkd3 R.norvegicus
XP_419017.3 FASTKD3 G.gallus
XP_001338251.1 fastkd3 D.rerio
NP_001135619.2 fastkd3 X.tropicalis


Support Center