Display Settings:

Format

Send to:

Choose Destination
HomoloGene:111037. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_113645.1          1   --------------------------------------MNSMTSAVPVAN   12
XP_508463.2          1   --------------------------------------MNSMTSAVPVAN   12
XP_001085445.1       1   --------------------------------------MNSMTSAVPVAN   12
NP_001029228.1       1   --------------------------------------MNPTTSAGPMAN   12
NP_071875.2          1   MNRPTAQGAVNLSGSKFSTAKSWEPEQERLTWQPGTVSMNTVTSPGPMAN   50
NP_001101989.1       1   --------------------------------------MNTVTSQGPVAN   12


NP_113645.1         13   SVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPV   62
XP_508463.2         13   SVLVVAPHNGYPVTPGIMSQVPLYPNSQPQVHLVPGNPPSLVSNVNGQPV   62
XP_001085445.1      13   SVLVVAPHNGYPATPGIMSQVPLYPNNQPQVHLVPGNPPGLMSNVNRQPV   62
NP_001029228.1      13   SVFVVTPPNGYTVLPGGVSQVPIYP-NQSQVHVIHGNPP----CVSQQPT   57
NP_071875.2         51   SVYVVAPPNSYPVVPGTVPQMPIYPSNQPQVHVISGHLPGLVPAMTEPPA   100
NP_001101989.1      13   SVYVVAPHNSYPVVPGTMPQVPLYPSNQPQVHVIPGNLPGLVPAMTEPPA   62


NP_113645.1         63   QKALKEGKTLGAIQIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGG   112
XP_508463.2         63   QKALKEGKTLGAIQIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGG   112
XP_001085445.1      63   QKTLKEGKTLGAIQIIIGLAHIGLGSIMGTVLVGDYLSISFYGGFPFWGG   112
NP_001029228.1      58   ERTLKEGKALGATQILIGLIHLGLGSVMGTVLMGNYTAVSFYGGFPFWGG   107
NP_071875.2        101   QRVLKKGQVLGAIQILIGLVHIGLGSIMITNLFSHYTPVSLYGGFPFWGG   150
NP_001101989.1      63   QRVLKKGQVLGAIQILIGLVHIGLGSIMITNLFSLYTPVSLYGGFPFWGG   112


NP_113645.1        113   LWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSI   162
XP_508463.2        113   LWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSI   162
XP_001085445.1     113   LWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSI   162
NP_001029228.1     108   IWFIISGSLSVLAEKHSRSSCLLNSSVGFNIVSAIFSMVGITLFIVELII   157
NP_071875.2        151   IWFIISGSLSVAAETQPNSPCLLNGSVGLNIFSAICSAVGIMLFITDISI   200
NP_001101989.1     113   IWFIISGSLSVAAETQPNSPCLLNGSVGLNIFSAICSAVGIILFITDISI   162


NP_113645.1        163   PHPYAYPDYYPYA--WGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLV   210
XP_508463.2        163   PHPYAYPNYYPYA--WGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLV   210
XP_001085445.1     163   PHPYAYPNYYSYA--WGVNPGLAISGVMLVFCLLEFGIACTSSHFGCQLV   210
NP_001029228.1     158   NSTYIYPLYDPPSHTWGRVPGMAVSGLLLIFCILEVFIASISAHFGCQLT   207
NP_071875.2        201   SSGYIYPSYYPYQENLGVRTGVAISSVLLIFCLLELSIASVSSHFGCQVA   250
NP_001101989.1     163   SGGYVYPDYYPYHD-YGVSTGVAISCVLLIFCLLELSIASVSSHFGCQVA   211


NP_113645.1        211   CCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK   250
XP_508463.2        211   CCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK   250
XP_001085445.1     211   CCQSSNVSVMYPNVYAANPVVIPEPVTSPPSYSSEFQANK   250
NP_001029228.1     208   CYQTNNVGVVIPNVYVTNPAVIPEPENSPPNYSDVPRDK-   246
NP_071875.2        251   CCHYNNPGVVIPNVYAANPVVIPEPPNPIPSYSEVVQDSR   290
NP_001101989.1     212   CCRYNNVDVVIPNVYATNTVVFPEPPNPIPSYSDAIRDSR   251


Protein Acc. Gene Organism
NP_113645.1 MS4A8 H.sapiens
XP_508463.2 MS4A8B P.troglodytes
XP_001085445.1 MS4A8B M.mulatta
NP_001029228.1 MS4A8B B.taurus
NP_071875.2 Ms4a8a M.musculus
NP_001101989.1 Ms4a8 R.norvegicus


Support Center