Display Settings:

Format

Send to:

Choose Destination
HomoloGene:104312. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_940975.2          1   MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPN   50
XP_003312104.1       1   MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPN   50
XP_001097511.1       1   MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPN   50
XP_003431614.1       1   MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADIDSLSESSPN   50
NP_081423.1          1   MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPN   50
NP_001269265.1       1   MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPN   50


NP_940975.2         51   SSPGPCPEKAPPPQKPSHEGSYLLQP   76
XP_003312104.1      51   SSPGPCPEKAPPPQKPSHEGSYLLQP   76
XP_001097511.1      51   SSPGPCPEKAPPPQKPSHEGSYLLQP   76
XP_003431614.1      51   SSPGPCPEKAPPPQKPSHEGSYLLQP   76
NP_081423.1         51   SSPGPCPEKAPPPQKPSHEGSYLLQP   76
NP_001269265.1      51   SSPGPCPEKAPPPQKPSHEGSYLLQP   76


Protein Acc. Gene Organism
NP_940975.2 ENHO H.sapiens
XP_003312104.1 ENHO P.troglodytes
XP_001097511.1 ENHO M.mulatta
XP_003431614.1 ENHO C.lupus
NP_081423.1 Enho M.musculus
NP_001269265.1 LOC100912292 R.norvegicus


Support Center