NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|755567283|ref|XP_011248127|]
View 

sp110 nuclear body protein-like isoform X1 [Mus musculus]

Protein Classification

HSR and SAND domain-containing protein (domain architecture ID 10504717)

HSR and SAND domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HSR pfam03172
HSR domain; The Sp100 protein is a constituent of nuclear domains, also known as nuclear dots ...
31-129 8.34e-57

HSR domain; The Sp100 protein is a constituent of nuclear domains, also known as nuclear dots (NDs). An ND-targeting region that coincides with a homodimerization domain was mapped in Sp100. Sequences similar to the Sp100 homodimerization/ND-targeting region occur in several other proteins and constitute a novel protein motif, termed HSR domain (for homogeneously-staining region). The HSR domain has also been named ASS (AIRE, Sp-100 and Sp140). This domain is usually found at the amino terminus of proteins that contain a SAND domain pfam01342.


:

Pssm-ID: 397335  Cd Length: 99  Bit Score: 183.12  E-value: 8.34e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755567283   31 LEKALLQHFIYMKVNIAYAINKPFPFFEALRDKSFITERMYKESLEACLNLVPLSKVVYNILSSLEQTFHPSVLLTLFSK 110
Cdd:pfam03172   1 LEEALFQHFKENKVEIAYAIKKPFPFLEGLRDHSFITEKMYKESLEACRNLVPVQRVVYNVLSELEKTFSLSLLEALFSD 80
                          90
                  ....*....|....*....
gi 755567283  111 VNLREYPSLVAIFRSFRNV 129
Cdd:pfam03172  81 VNLKEYPDLIEILRSFPNV 99
SAND pfam01342
SAND domain; The DNA binding activity of two proteins has been mapped to the SAND domain. The ...
387-459 3.37e-29

SAND domain; The DNA binding activity of two proteins has been mapped to the SAND domain. The conserved KDWK motif is necessary for DNA binding, and it appears to be important for dimerization. This region is also found in the putative transcription factor RegA from the multicellular green alga Volvox cateri. This region of RegA is known as the VARL domain.


:

Pssm-ID: 396076  Cd Length: 75  Bit Score: 109.19  E-value: 3.37e-29
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 755567283  387 PTLPVTCGKAKGTLFQEKLKQGASKKCIQNEaGDWLTVKEFLNEGRRATSKAWKGVICCNGATLRHLEQKGLL 459
Cdd:pfam01342   4 PVLPVTCGEAKGILHKEKFKQGISGKCIQTE-DSWLTPKEFEIEGGKAKSKDWKRSIRCGGKPLRELIEKGIL 75
 
Name Accession Description Interval E-value
HSR pfam03172
HSR domain; The Sp100 protein is a constituent of nuclear domains, also known as nuclear dots ...
31-129 8.34e-57

HSR domain; The Sp100 protein is a constituent of nuclear domains, also known as nuclear dots (NDs). An ND-targeting region that coincides with a homodimerization domain was mapped in Sp100. Sequences similar to the Sp100 homodimerization/ND-targeting region occur in several other proteins and constitute a novel protein motif, termed HSR domain (for homogeneously-staining region). The HSR domain has also been named ASS (AIRE, Sp-100 and Sp140). This domain is usually found at the amino terminus of proteins that contain a SAND domain pfam01342.


Pssm-ID: 397335  Cd Length: 99  Bit Score: 183.12  E-value: 8.34e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755567283   31 LEKALLQHFIYMKVNIAYAINKPFPFFEALRDKSFITERMYKESLEACLNLVPLSKVVYNILSSLEQTFHPSVLLTLFSK 110
Cdd:pfam03172   1 LEEALFQHFKENKVEIAYAIKKPFPFLEGLRDHSFITEKMYKESLEACRNLVPVQRVVYNVLSELEKTFSLSLLEALFSD 80
                          90
                  ....*....|....*....
gi 755567283  111 VNLREYPSLVAIFRSFRNV 129
Cdd:pfam03172  81 VNLKEYPDLIEILRSFPNV 99
SAND pfam01342
SAND domain; The DNA binding activity of two proteins has been mapped to the SAND domain. The ...
387-459 3.37e-29

SAND domain; The DNA binding activity of two proteins has been mapped to the SAND domain. The conserved KDWK motif is necessary for DNA binding, and it appears to be important for dimerization. This region is also found in the putative transcription factor RegA from the multicellular green alga Volvox cateri. This region of RegA is known as the VARL domain.


Pssm-ID: 396076  Cd Length: 75  Bit Score: 109.19  E-value: 3.37e-29
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 755567283  387 PTLPVTCGKAKGTLFQEKLKQGASKKCIQNEaGDWLTVKEFLNEGRRATSKAWKGVICCNGATLRHLEQKGLL 459
Cdd:pfam01342   4 PVLPVTCGEAKGILHKEKFKQGISGKCIQTE-DSWLTPKEFEIEGGKAKSKDWKRSIRCGGKPLRELIEKGIL 75
SAND smart00258
SAND domain;
387-459 1.04e-21

SAND domain;


Pssm-ID: 128554  Cd Length: 73  Bit Score: 88.56  E-value: 1.04e-21
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 755567283   387 PTLPVTCGKAKGTLFQEKLKQGASKKCIQNEaGDWLTVKEFLNEGRRATSKAWKGVICCNGATLRHLEQKGLL 459
Cdd:smart00258   1 SELPVTCGTVKGILYKKKFKCGISVKCIQYE-DKWFTPKEFEIEGGKGKSKDWKRSIRCGGSSLRTLMENGTL 72
 
Name Accession Description Interval E-value
HSR pfam03172
HSR domain; The Sp100 protein is a constituent of nuclear domains, also known as nuclear dots ...
31-129 8.34e-57

HSR domain; The Sp100 protein is a constituent of nuclear domains, also known as nuclear dots (NDs). An ND-targeting region that coincides with a homodimerization domain was mapped in Sp100. Sequences similar to the Sp100 homodimerization/ND-targeting region occur in several other proteins and constitute a novel protein motif, termed HSR domain (for homogeneously-staining region). The HSR domain has also been named ASS (AIRE, Sp-100 and Sp140). This domain is usually found at the amino terminus of proteins that contain a SAND domain pfam01342.


Pssm-ID: 397335  Cd Length: 99  Bit Score: 183.12  E-value: 8.34e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755567283   31 LEKALLQHFIYMKVNIAYAINKPFPFFEALRDKSFITERMYKESLEACLNLVPLSKVVYNILSSLEQTFHPSVLLTLFSK 110
Cdd:pfam03172   1 LEEALFQHFKENKVEIAYAIKKPFPFLEGLRDHSFITEKMYKESLEACRNLVPVQRVVYNVLSELEKTFSLSLLEALFSD 80
                          90
                  ....*....|....*....
gi 755567283  111 VNLREYPSLVAIFRSFRNV 129
Cdd:pfam03172  81 VNLKEYPDLIEILRSFPNV 99
SAND pfam01342
SAND domain; The DNA binding activity of two proteins has been mapped to the SAND domain. The ...
387-459 3.37e-29

SAND domain; The DNA binding activity of two proteins has been mapped to the SAND domain. The conserved KDWK motif is necessary for DNA binding, and it appears to be important for dimerization. This region is also found in the putative transcription factor RegA from the multicellular green alga Volvox cateri. This region of RegA is known as the VARL domain.


Pssm-ID: 396076  Cd Length: 75  Bit Score: 109.19  E-value: 3.37e-29
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 755567283  387 PTLPVTCGKAKGTLFQEKLKQGASKKCIQNEaGDWLTVKEFLNEGRRATSKAWKGVICCNGATLRHLEQKGLL 459
Cdd:pfam01342   4 PVLPVTCGEAKGILHKEKFKQGISGKCIQTE-DSWLTPKEFEIEGGKAKSKDWKRSIRCGGKPLRELIEKGIL 75
SAND smart00258
SAND domain;
387-459 1.04e-21

SAND domain;


Pssm-ID: 128554  Cd Length: 73  Bit Score: 88.56  E-value: 1.04e-21
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 755567283   387 PTLPVTCGKAKGTLFQEKLKQGASKKCIQNEaGDWLTVKEFLNEGRRATSKAWKGVICCNGATLRHLEQKGLL 459
Cdd:smart00258   1 SELPVTCGTVKGILYKKKFKCGISVKCIQYE-DKWFTPKEFEIEGGKGKSKDWKRSIRCGGSSLRTLMENGTL 72
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH