NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|694944643|ref|XP_009458713|]
View 

pre-mRNA-processing factor 19 isoform X2 [Pan troglodytes]

Protein Classification

Prp19 and WD40 domain-containing protein (domain architecture ID 10554327)

Prp19 and WD40 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
138-418 1.01e-58

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


:

Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 193.32  E-value: 1.01e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 138 GILALDLCPsDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVV 217
Cdd:cd00200   11 GVTCVAFSP-DGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGECVRTL 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 218 RAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETsgCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKER 297
Cdd:cd00200   90 TGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHT--DWVNSVAFSPDGTFVASSSQDGTIKLWDLRTG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 298 TNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFeVKSLIFDQSGTYLALGGTD--VQIY 375
Cdd:cd00200  168 KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENG-VNSVAFSPDGYLLASGSEDgtIRVW 246
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 694944643 376 ICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 418
Cdd:cd00200  247 DLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289
Prp19 pfam08606
Prp19/Pso4-like; This regions is found specifically in PRP19-like protein. The region ...
1-48 2.52e-25

Prp19/Pso4-like; This regions is found specifically in PRP19-like protein. The region represented by this family covers the sequence implicated in self-interaction and a coiled-coiled motif. PRP19-like proteins form an oligomer that is necessary for spliceosome assembly.


:

Pssm-ID: 400774  Cd Length: 65  Bit Score: 97.59  E-value: 2.52e-25
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 694944643    1 MLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALAT 48
Cdd:pfam08606  18 MLETFTLRKQLDQTRQELSHALYQHDAACRVIARLIKERDEAREALAN 65
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
138-418 1.01e-58

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 193.32  E-value: 1.01e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 138 GILALDLCPsDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVV 217
Cdd:cd00200   11 GVTCVAFSP-DGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGECVRTL 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 218 RAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETsgCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKER 297
Cdd:cd00200   90 TGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHT--DWVNSVAFSPDGTFVASSSQDGTIKLWDLRTG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 298 TNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFeVKSLIFDQSGTYLALGGTD--VQIY 375
Cdd:cd00200  168 KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENG-VNSVAFSPDGYLLASGSEDgtIRVW 246
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 694944643 376 ICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 418
Cdd:cd00200  247 DLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289
WD40 COG2319
WD40 repeat [General function prediction only];
139-419 7.13e-37

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 140.22  E-value: 7.13e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 139 ILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVF-SASPDATIRIWSVPNASCVQVV 217
Cdd:COG2319  158 VTSLAFSPDGKLLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIaSGSSDGTIRLWDLSTGKLLRST 237
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 218 RAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGcSLTCAQFHPDGLIFGTGTMDSQIKIWDL--K 295
Cdd:COG2319  238 LSGHSDSVVSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSS-SVLSVAFSPDGKLLASGSSDGTVRLWDLetG 316
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 296 ERTNVANFPGHSGPITSIAFSENGYYLATA-ADDSSVKLWDLRKLKNFKTLQLDNNfeVKSLIFDQSGTYLALGGTDVQI 374
Cdd:COG2319  317 KLLSSLTLKGHEGPVSSLSFSPDGSLLVSGgSDDGTIRLWDLRTGKPLKTLEGHSN--VLSVSFSPDGRVVSSGSTDGTV 394
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 694944643 375 YICKQWTEILH--FTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL 419
Cdd:COG2319  395 RLWDLSTGSLLrnLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDL 441
Prp19 pfam08606
Prp19/Pso4-like; This regions is found specifically in PRP19-like protein. The region ...
1-48 2.52e-25

Prp19/Pso4-like; This regions is found specifically in PRP19-like protein. The region represented by this family covers the sequence implicated in self-interaction and a coiled-coiled motif. PRP19-like proteins form an oligomer that is necessary for spliceosome assembly.


Pssm-ID: 400774  Cd Length: 65  Bit Score: 97.59  E-value: 2.52e-25
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 694944643    1 MLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALAT 48
Cdd:pfam08606  18 MLETFTLRKQLDQTRQELSHALYQHDAACRVIARLIKERDEAREALAN 65
PTZ00421 PTZ00421
coronin; Provisional
146-296 3.06e-12

coronin; Provisional


Pssm-ID: 173611 [Multi-domain]  Cd Length: 493  Bit Score: 68.00  E-value: 3.06e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 146 PSDTNKILTGGADKNVVVFDKSSEQI-------LATLKGHTKKVTSVVFHPSQDLVF-SASPDATIRIWSVPNASCVQVV 217
Cdd:PTZ00421  85 PFDPQKLFTASEDGTIMGWGIPEEGLtqnisdpIVHLQGHTKKVGIVSFHPSAMNVLaSAGADMVVNVWDVERGKAVEVI 164
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 218 RAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLI--FGTGTMDS-QIKIWDL 294
Cdd:PTZ00421 165 KCHSDQITSLEWNLDGSLLCTTSKDKKLNIIDPRDGTIVSSVEAHASAKSQRCLWAKRKDLIitLGCSKSQQrQIMLWDT 244

                 ..
gi 694944643 295 KE 296
Cdd:PTZ00421 245 RK 246
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
300-335 1.69e-09

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 52.70  E-value: 1.69e-09
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 694944643   300 VANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD 335
Cdd:smart00320   5 LKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
170-207 1.88e-08

WD domain, G-beta repeat;


Pssm-ID: 395323 [Multi-domain]  Cd Length: 39  Bit Score: 49.67  E-value: 1.88e-08
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 694944643  170 QILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWS 207
Cdd:pfam00400   2 KLLKTLEGHTSSVTSLAFSPDGKLLASGSDDGTVKVWD 39
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
138-418 1.01e-58

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 193.32  E-value: 1.01e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 138 GILALDLCPsDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVV 217
Cdd:cd00200   11 GVTCVAFSP-DGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGECVRTL 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 218 RAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETsgCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKER 297
Cdd:cd00200   90 TGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHT--DWVNSVAFSPDGTFVASSSQDGTIKLWDLRTG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 298 TNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFeVKSLIFDQSGTYLALGGTD--VQIY 375
Cdd:cd00200  168 KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENG-VNSVAFSPDGYLLASGSEDgtIRVW 246
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 694944643 376 ICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 418
Cdd:cd00200  247 DLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
132-376 8.56e-58

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 191.01  E-value: 8.56e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 132 HSASIPGILALdlcpSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNA 211
Cdd:cd00200   50 HTGPVRDVAAS----ADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETG 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 212 SCVQVVRAHESAVTGLSLHATGDYLLSSSDDQY---WafsDIQTGRVLTKVTDETSgcSLTCAQFHPDGLIFGTGTMDSQ 288
Cdd:cd00200  126 KCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTiklW---DLRTGKCVATLTGHTG--EVNSVAFSPDGEKLLSSSSDGT 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 289 IKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFeVKSLIFDQSGTYLALG 368
Cdd:cd00200  201 IKLWDLSTGKCLGTLRGHENGVNSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNS-VTSLAWSPDGKRLASG 279

                 ....*...
gi 694944643 369 GTDVQIYI 376
Cdd:cd00200  280 SADGTIRI 287
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
172-419 1.86e-49

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 169.05  E-value: 1.86e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 172 LATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQY---Wafs 248
Cdd:cd00200    2 RRTLKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGSSDKTirlW--- 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 249 DIQTGRVLTKVTDETSGCSltCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADD 328
Cdd:cd00200   79 DLETGECVRTLTGHTSYVS--SVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQD 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 329 SSVKLWDLRKLKNFKTLqLDNNFEVKSLIFDQSGTYLALGGTDVQIYI--CKQWTEILHFTEHSGLTTGVAFGHHAKFIA 406
Cdd:cd00200  157 GTIKLWDLRTGKCVATL-TGHTGEVNSVAFSPDGEKLLSSSSDGTIKLwdLSTGKCLGTLRGHENGVNSVAFSPDGYLLA 235
                        250
                 ....*....|...
gi 694944643 407 STGMDRSLKFYSL 419
Cdd:cd00200  236 SGSEDGTIRVWDL 248
WD40 COG2319
WD40 repeat [General function prediction only];
139-419 7.13e-37

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 140.22  E-value: 7.13e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 139 ILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVF-SASPDATIRIWSVPNASCVQVV 217
Cdd:COG2319  158 VTSLAFSPDGKLLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIaSGSSDGTIRLWDLSTGKLLRST 237
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 218 RAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGcSLTCAQFHPDGLIFGTGTMDSQIKIWDL--K 295
Cdd:COG2319  238 LSGHSDSVVSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSS-SVLSVAFSPDGKLLASGSSDGTVRLWDLetG 316
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 296 ERTNVANFPGHSGPITSIAFSENGYYLATA-ADDSSVKLWDLRKLKNFKTLQLDNNfeVKSLIFDQSGTYLALGGTDVQI 374
Cdd:COG2319  317 KLLSSLTLKGHEGPVSSLSFSPDGSLLVSGgSDDGTIRLWDLRTGKPLKTLEGHSN--VLSVSFSPDGRVVSSGSTDGTV 394
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 694944643 375 YICKQWTEILH--FTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL 419
Cdd:COG2319  395 RLWDLSTGSLLrnLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDL 441
WD40 COG2319
WD40 repeat [General function prediction only];
127-388 4.43e-36

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 137.91  E-value: 4.43e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 127 SHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILA-TLKGHTKKVTSVvFHPSQDLVFSASPDATIRI 205
Cdd:COG2319  189 KPLSTLAGHTDPVSSLAFSPDGGLLIASGSSDGTIRLWDLSTGKLLRsTLSGHSDSVVSS-FSPDGSLLASGSSDGTIRL 267
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 206 WSVPN-ASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDG-LIFGTG 283
Cdd:COG2319  268 WDLRSsSSLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTLKGHEGPVSSLSFSPDGsLLVSGG 347
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 284 TMDSQIKIWDLKERTNVANFPGHSgPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLqLDNNFEVKSLIFDQSGT 363
Cdd:COG2319  348 SDDGTIRLWDLRTGKPLKTLEGHS-NVLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLRNL-DGHTSRVTSLDFSPDGK 425
                        250       260
                 ....*....|....*....|....*..
gi 694944643 364 YLALGGTD--VQIYICKQWTEILHFTE 388
Cdd:COG2319  426 SLASGSSDntIRLWDLKTSLKSVSFSP 452
WD40 COG2319
WD40 repeat [General function prediction only];
147-357 9.17e-32

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 125.97  E-value: 9.17e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 147 SDTNKILTGGADKNVVVFD-KSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVR--AHESA 223
Cdd:COG2319  251 PDGSLLASGSSDGTIRLWDlRSSSSLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTlkGHEGP 330
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 224 VTGLSLHATGDYLLSS-SDDQYWAFSDIQTGRVLTKVTDETSgcsLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVAN 302
Cdd:COG2319  331 VSSLSFSPDGSLLVSGgSDDGTIRLWDLRTGKPLKTLEGHSN---VLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLRN 407
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 694944643 303 FPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLI 357
Cdd:COG2319  408 LDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKTSLKSVSFSPDGKVLASKSS 462
WD40 COG2319
WD40 repeat [General function prediction only];
132-419 1.17e-30

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 122.89  E-value: 1.17e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 132 HSASIPGILaldlCPSDTNKILTGGADKNVVVFD-KSSEQILATLKG-HTKKVTSV-VFHPSQDLVFSA--SPDATIRIW 206
Cdd:COG2319   64 HEDSITSIA----FSPDGELLLSGSSDGTIKLWDlDNGEKLIKSLEGlHDSSVSKLaLSSPDGNSILLAssSLDGTVKLW 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 207 SVPNA-SCVQVVRAHESAVTGLSLHATGDYLLSSSD-DQYWAFSDIQTGRVLTKVTDETSgcSLTCAQFHPDG-LIFGTG 283
Cdd:COG2319  140 DLSTPgKLIRTLEGHSESVTSLAFSPDGKLLASGSSlDGTIKLWDLRTGKPLSTLAGHTD--PVSSLAFSPDGgLLIASG 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 284 TMDSQIKIWDLKERTNVAN-FPGHSGPITSiAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSG 362
Cdd:COG2319  218 SSDGTIRLWDLSTGKLLRStLSGHSDSVVS-SFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSPDG 296
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 694944643 363 TYLALGGTDVQIYIC----KQWTEILHFTEHSGLTTGVAFGHHAKFIASTGM-DRSLKFYSL 419
Cdd:COG2319  297 KLLASGSSDGTVRLWdletGKLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSdDGTIRLWDL 358
WD40 COG2319
WD40 repeat [General function prediction only];
174-419 8.02e-30

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 120.19  E-value: 8.02e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 174 TLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNAS-CVQVVR-AHESAVTGLSL-HATGDYLLS--SSDDQYWAFS 248
Cdd:COG2319   60 LLRGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGEkLIKSLEgLHDSSVSKLALsSPDGNSILLasSSLDGTVKLW 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 249 DIQTGRVLTKVTDETSGcSLTCAQFHPDG-LIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENG-YYLATAA 326
Cdd:COG2319  140 DLSTPGKLIRTLEGHSE-SVTSLAFSPDGkLLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGgLLIASGS 218
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 327 DDSSVKLWDLRKLKNFKTLqLDNNFEVKSLIFDQSGTYLALGGTDVQIYICK---QWTEILHFTEHSGLTTGVAFGHHAK 403
Cdd:COG2319  219 SDGTIRLWDLSTGKLLRST-LSGHSDSVVSSFSPDGSLLASGSSDGTIRLWDlrsSSSLLRTLSGHSSSVLSVAFSPDGK 297
                        250
                 ....*....|....*.
gi 694944643 404 FIASTGMDRSLKFYSL 419
Cdd:COG2319  298 LLASGSSDGTVRLWDL 313
Prp19 pfam08606
Prp19/Pso4-like; This regions is found specifically in PRP19-like protein. The region ...
1-48 2.52e-25

Prp19/Pso4-like; This regions is found specifically in PRP19-like protein. The region represented by this family covers the sequence implicated in self-interaction and a coiled-coiled motif. PRP19-like proteins form an oligomer that is necessary for spliceosome assembly.


Pssm-ID: 400774  Cd Length: 65  Bit Score: 97.59  E-value: 2.52e-25
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 694944643    1 MLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALAT 48
Cdd:pfam08606  18 MLETFTLRKQLDQTRQELSHALYQHDAACRVIARLIKERDEAREALAN 65
WD40 COG2319
WD40 repeat [General function prediction only];
164-419 1.59e-20

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 93.23  E-value: 1.59e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 164 FDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNascvQVVRAHESAVTGLSLHATGDYLLSSSDDQ 243
Cdd:COG2319   12 KSKLLKKSELGPSLNSLSLLSLGSSESGILLLALLSDSLVSLPDLSS----LLLRGHEDSITSIAFSPDGELLLSGSSDG 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 244 YWAFSDIQTGRVLTKVTDETSGCSLTCAQF-HPDG--LIFGTGTMDSQIKIWDL-KERTNVANFPGHSGPITSIAFSENG 319
Cdd:COG2319   88 TIKLWDLDNGEKLIKSLEGLHDSSVSKLALsSPDGnsILLASSSLDGTVKLWDLsTPGKLIRTLEGHSESVTSLAFSPDG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 320 YYLATAAD-DSSVKLWDLRKLKNFKTLQLDNNfEVKSLIFDQSGTYLALGGTD---VQIYICKQWTEI-LHFTEHSGLTT 394
Cdd:COG2319  168 KLLASGSSlDGTIKLWDLRTGKPLSTLAGHTD-PVSSLAFSPDGGLLIASGSSdgtIRLWDLSTGKLLrSTLSGHSDSVV 246
                        250       260
                 ....*....|....*....|....*
gi 694944643 395 GvAFGHHAKFIASTGMDRSLKFYSL 419
Cdd:COG2319  247 S-SFSPDGSLLASGSSDGTIRLWDL 270
PTZ00421 PTZ00421
coronin; Provisional
146-296 3.06e-12

coronin; Provisional


Pssm-ID: 173611 [Multi-domain]  Cd Length: 493  Bit Score: 68.00  E-value: 3.06e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 146 PSDTNKILTGGADKNVVVFDKSSEQI-------LATLKGHTKKVTSVVFHPSQDLVF-SASPDATIRIWSVPNASCVQVV 217
Cdd:PTZ00421  85 PFDPQKLFTASEDGTIMGWGIPEEGLtqnisdpIVHLQGHTKKVGIVSFHPSAMNVLaSAGADMVVNVWDVERGKAVEVI 164
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 218 RAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLI--FGTGTMDS-QIKIWDL 294
Cdd:PTZ00421 165 KCHSDQITSLEWNLDGSLLCTTSKDKKLNIIDPRDGTIVSSVEAHASAKSQRCLWAKRKDLIitLGCSKSQQrQIMLWDT 244

                 ..
gi 694944643 295 KE 296
Cdd:PTZ00421 245 RK 246
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
300-335 1.69e-09

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 52.70  E-value: 1.69e-09
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 694944643   300 VANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD 335
Cdd:smart00320   5 LKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
131-336 1.29e-08

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 57.02  E-value: 1.29e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 131 LHSASIPGILALDlcpSDTNKILTGGADKNVVVFD-----KSSEQI---LATLKGHTKkVTSVVFHPS-QDLVFSASPDA 201
Cdd:PLN00181 480 LNSSNLVCAIGFD---RDGEFFATAGVNKKIKIFEcesiiKDGRDIhypVVELASRSK-LSGICWNSYiKSQVASSNFEG 555
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 202 TIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSS-SDDQYWAFSDIQTGRVLTKVTDETSGCsltCAQFHPD-GLI 279
Cdd:PLN00181 556 VVQVWDVARSQLVTEMKEHEKRVWSIDYSSADPTLLASgSDDGSVKLWSINQGVSIGTIKTKANIC---CVQFPSEsGRS 632
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 694944643 280 FGTGTMDSQIKIWDLKE-RTNVANFPGHSGPITSIAFSENGyYLATAADDSSVKLWDL 336
Cdd:PLN00181 633 LAFGSADHKVYYYDLRNpKLPLCTMIGHSKTVSYVRFVDSS-TLVSSSTDNTLKLWDL 689
WD40 pfam00400
WD domain, G-beta repeat;
170-207 1.88e-08

WD domain, G-beta repeat;


Pssm-ID: 395323 [Multi-domain]  Cd Length: 39  Bit Score: 49.67  E-value: 1.88e-08
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 694944643  170 QILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWS 207
Cdd:pfam00400   2 KLLKTLEGHTSSVTSLAFSPDGKLLASGSDDGTVKVWD 39
WD40 pfam00400
WD domain, G-beta repeat;
300-335 2.31e-08

WD domain, G-beta repeat;


Pssm-ID: 395323 [Multi-domain]  Cd Length: 39  Bit Score: 49.67  E-value: 2.31e-08
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 694944643  300 VANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD 335
Cdd:pfam00400   4 LKTLEGHTSSVTSLAFSPDGKLLASGSDDGTVKVWD 39
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
168-207 2.33e-08

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 49.62  E-value: 2.33e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 694944643   168 SEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWS 207
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
PTZ00420 PTZ00420
coronin; Provisional
175-349 3.17e-06

coronin; Provisional


Pssm-ID: 240412 [Multi-domain]  Cd Length: 568  Bit Score: 49.18  E-value: 3.17e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 175 LKGHTKKVTSVVFHPS-QDLVFSASPDATIRIWSVP-NASCVQ-------VVRAHESAVTGLSLHATGDYLLSSSD-DQY 244
Cdd:PTZ00420  70 LKGHTSSILDLQFNPCfSEILASGSEDLTIRVWEIPhNDESVKeikdpqcILKGHKKKISIIDWNPMNYYIMCSSGfDSF 149
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 245 WAFSDIQTGRVLTKVTDETSGCSLtcaQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGP--------------- 309
Cdd:PTZ00420 150 VNIWDIENEKRAFQINMPKKLSSL---KWNIKGNLLSGTCVGKHMHIIDPRKQEIASSFHIHDGGkntkniwidglggdd 226
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 694944643 310 --ITSIAFSENGYylataaddSSVKLWDLRKLKN-FKTLQLDN 349
Cdd:PTZ00420 227 nyILSTGFSKNNM--------REMKLWDLKNTTSaLVTMSIDN 261
CDC55 COG5170
Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms];
213-347 1.59e-05

Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms];


Pssm-ID: 227498  Cd Length: 460  Bit Score: 46.95  E-value: 1.59e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 213 CVQVVRAHESAVTGLSLHATGDYLLSSSD-----------DQYWAFSDIQTgrvlTKVTDETSgcSLTCAQFHP-DGLIF 280
Cdd:COG5170  164 CRVYANAHPYHINSISFNSDKETLLSADDlrinlwnleiiDGSFNIVDIKP----HNMEELTE--VITSAEFHPeMCNVF 237
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643 281 GTGTMDSQIKIWDLKERT----------------NVANFPGHSGPITSIAFSENGYYLAtAADDSSVKLWDLRKLKN-FK 343
Cdd:COG5170  238 MYSSSKGEIKLNDLRQSAlcdnskklfeltidgvDVDFFEEIVSSISDFKFSDNGRYIL-SRDYLTVKIWDVNMAKNpIK 316

                 ....
gi 694944643 344 TLQL 347
Cdd:COG5170  317 TIPM 320
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
252-293 5.50e-04

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 37.29  E-value: 5.50e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 694944643   252 TGRVLTKVTDETSGCslTCAQFHPDGLIFGTGTMDSQIKIWD 293
Cdd:smart00320   1 SGELLKTLKGHTGPV--TSVAFSPDGKYLASGSDDGTIKLWD 40
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
212-242 1.59e-03

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 36.14  E-value: 1.59e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 694944643   212 SCVQVVRAHESAVTGLSLHATGDYLLSSSDD 242
Cdd:smart00320   3 ELLKTLKGHTGPVTSVAFSPDGKYLASGSDD 33
WD40 pfam00400
WD domain, G-beta repeat;
212-242 1.87e-03

WD domain, G-beta repeat;


Pssm-ID: 395323 [Multi-domain]  Cd Length: 39  Bit Score: 35.80  E-value: 1.87e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 694944643  212 SCVQVVRAHESAVTGLSLHATGDYLLSSSDD 242
Cdd:pfam00400   2 KLLKTLEGHTSSVTSLAFSPDGKLLASGSDD 32
ANAPC4_WD40 pfam12894
Anaphase-promoting complex subunit 4 WD40 domain; Apc4 contains an N-terminal propeller-shaped ...
237-318 2.79e-03

Anaphase-promoting complex subunit 4 WD40 domain; Apc4 contains an N-terminal propeller-shaped WD40 domain.The N-terminus of Afi1 serves to stabilize the union between Apc4 and Apc5, both of which lie towards the bottom-front of the APC,


Pssm-ID: 403945 [Multi-domain]  Cd Length: 91  Bit Score: 36.87  E-value: 2.79e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 694944643  237 LSSSDDQYWAF-SDIQtgRVLTKVTDETsGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAF 315
Cdd:pfam12894  12 LATEDGELLLHrLNWQ--RVWTLSPDKE-DLEVTSLAWRPDGKLLAVGYSDGTVRLLDAENGKIVHHFSAGSDLITCLGW 88

                  ...
gi 694944643  316 SEN 318
Cdd:pfam12894  89 GEN 91
WD40 pfam00400
WD domain, G-beta repeat;
267-293 5.69e-03

WD domain, G-beta repeat;


Pssm-ID: 395323 [Multi-domain]  Cd Length: 39  Bit Score: 34.26  E-value: 5.69e-03
                          10        20
                  ....*....|....*....|....*..
gi 694944643  267 SLTCAQFHPDGLIFGTGTMDSQIKIWD 293
Cdd:pfam00400  13 SVTSLAFSPDGKLLASGSDDGTVKVWD 39
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH