NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|383872860|ref|NP_001244627|]
View 

cystatin-B [Macaca mulatta]

Protein Classification

CY domain-containing protein (domain architecture ID 10440427)

CY domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Cystatin pfam00031
Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. ...
4-92 4.53e-23

Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. Typically, either the N-terminal or C-terminal end is very divergent. But splitting into two domains would make very short families. pfam00666 is related to this family but members have not been included.


:

Pssm-ID: 394988  Cd Length: 92  Bit Score: 84.70  E-value: 4.53e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 383872860   4 GAPSAVQPATAETQDIADQVRSQLEEKE-NKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFV-HLRVFKSLP-HENKPL 80
Cdd:pfam00031  1 GGLSPIPDNSPELQEALDFALAEYNAKTdNYYFELVEVKRAKSQVVAGTNYFIKVEVGETDCSkSKKLLEDCPlLDEKWL 80
                         90
                 ....*....|..
gi 383872860  81 TLSDYQTNKAKH 92
Cdd:pfam00031 81 GLCSAQVYKVPW 92
 
Name Accession Description Interval E-value
Cystatin pfam00031
Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. ...
4-92 4.53e-23

Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. Typically, either the N-terminal or C-terminal end is very divergent. But splitting into two domains would make very short families. pfam00666 is related to this family but members have not been included.


Pssm-ID: 394988  Cd Length: 92  Bit Score: 84.70  E-value: 4.53e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 383872860   4 GAPSAVQPATAETQDIADQVRSQLEEKE-NKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFV-HLRVFKSLP-HENKPL 80
Cdd:pfam00031  1 GGLSPIPDNSPELQEALDFALAEYNAKTdNYYFELVEVKRAKSQVVAGTNYFIKVEVGETDCSkSKKLLEDCPlLDEKWL 80
                         90
                 ....*....|..
gi 383872860  81 TLSDYQTNKAKH 92
Cdd:pfam00031 81 GLCSAQVYKVPW 92
CY smart00043
Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly ...
1-63 1.60e-15

Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.


Pssm-ID: 214484  Cd Length: 107  Bit Score: 65.91  E-value: 1.60e-15
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 383872860     1 MMCGAPSAVQPATAETQDIADQVRSQLEEKENKKF--PVFKAVSFKSQVVAGTNYFIKVHVGDED 63
Cdd:smart00043   1 LCLGGPSDVPPNDPEVQEAADFAVAEYNKKSNDKYelRVIKVVSAKSQVVAGTNYYLKVEVGETN 65
CY cd00042
Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly ...
4-79 2.36e-13

Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.


Pssm-ID: 238002  Cd Length: 105  Bit Score: 60.18  E-value: 2.36e-13
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 383872860   4 GAPSAVQPATAETQDIADQVRSQLEEKENKK-FPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFKSLPHENKP 79
Cdd:cd00042    1 GGPSDIPANDPEVQELADFAVAEYNKKSNDKyLEFFKVLSAKSQVVAGTNYYITVEAGDTNCKKSSVPLDCPDCKLL 77
 
Name Accession Description Interval E-value
Cystatin pfam00031
Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. ...
4-92 4.53e-23

Cystatin domain; Very diverse family. Attempts to define separate sub-families failed. Typically, either the N-terminal or C-terminal end is very divergent. But splitting into two domains would make very short families. pfam00666 is related to this family but members have not been included.


Pssm-ID: 394988  Cd Length: 92  Bit Score: 84.70  E-value: 4.53e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 383872860   4 GAPSAVQPATAETQDIADQVRSQLEEKE-NKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFV-HLRVFKSLP-HENKPL 80
Cdd:pfam00031  1 GGLSPIPDNSPELQEALDFALAEYNAKTdNYYFELVEVKRAKSQVVAGTNYFIKVEVGETDCSkSKKLLEDCPlLDEKWL 80
                         90
                 ....*....|..
gi 383872860  81 TLSDYQTNKAKH 92
Cdd:pfam00031 81 GLCSAQVYKVPW 92
CY smart00043
Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly ...
1-63 1.60e-15

Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.


Pssm-ID: 214484  Cd Length: 107  Bit Score: 65.91  E-value: 1.60e-15
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 383872860     1 MMCGAPSAVQPATAETQDIADQVRSQLEEKENKKF--PVFKAVSFKSQVVAGTNYFIKVHVGDED 63
Cdd:smart00043   1 LCLGGPSDVPPNDPEVQEAADFAVAEYNKKSNDKYelRVIKVVSAKSQVVAGTNYYLKVEVGETN 65
CY cd00042
Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly ...
4-79 2.36e-13

Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.


Pssm-ID: 238002  Cd Length: 105  Bit Score: 60.18  E-value: 2.36e-13
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 383872860   4 GAPSAVQPATAETQDIADQVRSQLEEKENKK-FPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFKSLPHENKP 79
Cdd:cd00042    1 GGPSDIPANDPEVQELADFAVAEYNKKSNDKyLEFFKVLSAKSQVVAGTNYYITVEAGDTNCKKSSVPLDCPDCKLL 77
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH