NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|254039605|ref|NP_001156790|]
View 

photoreceptor disk component PRCD precursor [Mus musculus]

Protein Classification

Rod_cone_degen domain-containing protein (domain architecture ID 10633566)

Rod_cone_degen domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Rod_cone_degen pfam15201
Progressive rod-cone degeneration; This family of proteins is involved in vision.
1-53 4.33e-31

Progressive rod-cone degeneration; This family of proteins is involved in vision.


:

Pssm-ID: 291855  Cd Length: 54  Bit Score: 102.01  E-value: 4.33e-31
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 254039605   1 MCTTLFLFS-LAMLWRRRFTNRVEPEPSRVDGTVVGSGSDTDLQSTGREKGPVK 53
Cdd:pfam15201  1 MCTTLFLLStLAMLWRRRFANRVQPEPSRVDGAVVGSGSDTDLQSSGREKEPLK 54
 
Name Accession Description Interval E-value
Rod_cone_degen pfam15201
Progressive rod-cone degeneration; This family of proteins is involved in vision.
1-53 4.33e-31

Progressive rod-cone degeneration; This family of proteins is involved in vision.


Pssm-ID: 291855  Cd Length: 54  Bit Score: 102.01  E-value: 4.33e-31
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 254039605   1 MCTTLFLFS-LAMLWRRRFTNRVEPEPSRVDGTVVGSGSDTDLQSTGREKGPVK 53
Cdd:pfam15201  1 MCTTLFLLStLAMLWRRRFANRVQPEPSRVDGAVVGSGSDTDLQSSGREKEPLK 54
 
Name Accession Description Interval E-value
Rod_cone_degen pfam15201
Progressive rod-cone degeneration; This family of proteins is involved in vision.
1-53 4.33e-31

Progressive rod-cone degeneration; This family of proteins is involved in vision.


Pssm-ID: 291855  Cd Length: 54  Bit Score: 102.01  E-value: 4.33e-31
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 254039605   1 MCTTLFLFS-LAMLWRRRFTNRVEPEPSRVDGTVVGSGSDTDLQSTGREKGPVK 53
Cdd:pfam15201  1 MCTTLFLLStLAMLWRRRFANRVQPEPSRVDGAVVGSGSDTDLQSSGREKEPLK 54
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH