NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157266271|ref|NP_001096638|]
View 

GATA-type zinc finger protein 1 [Mus musculus]

Protein Classification

GATA zinc finger domain-containing protein (domain architecture ID 12207019)

GATA zinc finger domain-containing protein binds to the DNA consensus sequence [AT]GATA[AG] and may function as a transcription factor/regulator

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ZnF_GATA smart00401
zinc finger binding to DNA consensus sequence [AT]GATA[AG];
194-231 3.53e-11

zinc finger binding to DNA consensus sequence [AT]GATA[AG];


:

Pssm-ID: 214648 [Multi-domain]  Cd Length: 52  Bit Score: 57.04  E-value: 3.53e-11
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 157266271   194 PRRCASCRTQRTPLWRDAEDGT-PLCNACGIRYKKYGTR 231
Cdd:smart00401   3 GRSCSNCGTTETPLWRRGPSGNkTLCNACGLYYKKHGGL 41
 
Name Accession Description Interval E-value
ZnF_GATA smart00401
zinc finger binding to DNA consensus sequence [AT]GATA[AG];
194-231 3.53e-11

zinc finger binding to DNA consensus sequence [AT]GATA[AG];


Pssm-ID: 214648 [Multi-domain]  Cd Length: 52  Bit Score: 57.04  E-value: 3.53e-11
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 157266271   194 PRRCASCRTQRTPLWRDAEDGT-PLCNACGIRYKKYGTR 231
Cdd:smart00401   3 GRSCSNCGTTETPLWRRGPSGNkTLCNACGLYYKKHGGL 41
GATA pfam00320
GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This ...
197-231 1.56e-10

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.


Pssm-ID: 395253  Cd Length: 36  Bit Score: 55.02  E-value: 1.56e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 157266271  197 CASCRTQRTPLWRDAEDGTP-LCNACGIRYKKYGTR 231
Cdd:pfam00320   1 CSNCGTTKTPLWRRGPNGNRtLCNACGLYYKKKGLK 36
ZnF_GATA cd00202
Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] ...
196-230 1.49e-09

Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C


Pssm-ID: 238123  Cd Length: 54  Bit Score: 52.76  E-value: 1.49e-09
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 157266271 196 RCASCRTQRTPLWR-DAEDGTPLCNACGIRYKKYGT 230
Cdd:cd00202    1 ACSNCGTTTTPLWRrGPSGGSTLCNACGLYWKKHGV 36
GAT1 COG5641
GATA Zn-finger-containing transcription factor [Transcription];
172-230 2.39e-04

GATA Zn-finger-containing transcription factor [Transcription];


Pssm-ID: 227928 [Multi-domain]  Cd Length: 498  Bit Score: 42.17  E-value: 2.39e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 157266271 172 SQKLPASPSKALASPGSSE-ALGPRRCASCRTQRTPLWRDAED-----GTPLCNACGIRYKKYGT 230
Cdd:COG5641  135 TTLNPGGTSSLNPNNNQSDnSNQPHVCSNCKTTSTPLWRRASSesslpGNNLCNACGLYLKLHGS 199
 
Name Accession Description Interval E-value
ZnF_GATA smart00401
zinc finger binding to DNA consensus sequence [AT]GATA[AG];
194-231 3.53e-11

zinc finger binding to DNA consensus sequence [AT]GATA[AG];


Pssm-ID: 214648 [Multi-domain]  Cd Length: 52  Bit Score: 57.04  E-value: 3.53e-11
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 157266271   194 PRRCASCRTQRTPLWRDAEDGT-PLCNACGIRYKKYGTR 231
Cdd:smart00401   3 GRSCSNCGTTETPLWRRGPSGNkTLCNACGLYYKKHGGL 41
GATA pfam00320
GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This ...
197-231 1.56e-10

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.


Pssm-ID: 395253  Cd Length: 36  Bit Score: 55.02  E-value: 1.56e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 157266271  197 CASCRTQRTPLWRDAEDGTP-LCNACGIRYKKYGTR 231
Cdd:pfam00320   1 CSNCGTTKTPLWRRGPNGNRtLCNACGLYYKKKGLK 36
ZnF_GATA cd00202
Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] ...
196-230 1.49e-09

Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C


Pssm-ID: 238123  Cd Length: 54  Bit Score: 52.76  E-value: 1.49e-09
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 157266271 196 RCASCRTQRTPLWR-DAEDGTPLCNACGIRYKKYGT 230
Cdd:cd00202    1 ACSNCGTTTTPLWRrGPSGGSTLCNACGLYWKKHGV 36
GAT1 COG5641
GATA Zn-finger-containing transcription factor [Transcription];
172-230 2.39e-04

GATA Zn-finger-containing transcription factor [Transcription];


Pssm-ID: 227928 [Multi-domain]  Cd Length: 498  Bit Score: 42.17  E-value: 2.39e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 157266271 172 SQKLPASPSKALASPGSSE-ALGPRRCASCRTQRTPLWRDAED-----GTPLCNACGIRYKKYGT 230
Cdd:COG5641  135 TTLNPGGTSSLNPNNNQSDnSNQPHVCSNCKTTSTPLWRRASSesslpGNNLCNACGLYLKLHGS 199
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH