NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|85093919|ref|XP_959787|]
View 

aconitase [Neurospora crassa OR74A]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
aconitase_mito super family cl36873
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
49-778 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


The actual alignment was detected with superfamily member TIGR01340:

Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1329.89  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919    49 YKKMSENLAVVRSRLN-RPLTYAEKILYSHLDNPHE----QDIE--RGVSYLRLRPDRVACQDATAQMAILQFMSAGMPS 121
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   122 VANPTTVHCDHLIEAQVGGEKDLERAININKEVYDFLASACAKYNIGFWKPGSGIIHQIILENYAFPGGLLIGTDSHTPN 201
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   202 AAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSA 281
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   282 TGKATCGNMGAEIGATTSVFPYDKAMFDYLVATKRSDIAEFAKT--YQKE-LQADEGAEYDQHIEINLNELEPHINGPFT 358
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTgqYSFFkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   359 PDLATPISKFAQAAKENNWPEELKVGLIGSCTNSSYEDMTRAASIARDALDHGLKAKAAFVVTPGSEQIRATIARDGQLQ 438
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   439 TFEEFGGTVLANACGPCIGQWDRRDT-PKGTPNSILSSYNRNFTGRNDGNPATHSFVTSPDLVVAMSIAGSLYFNPLTDS 517
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDDvKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   518 LKDKDGKEFKLQAPTGAGLPDRGYDPGQNTYQAPPAD-RATVQVQVSPTSDRLQVLSPFNAWNGKDATDMPILIKAQGKT 596
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSpNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   597 TTDHISMAGPWLKYRGHLDNISNNMLIGAINAANGEANKVQNFtTGEWDAVPAVARDYKAKNIPWVVIGDWNYGEGSSRE 676
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   677 HAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDKISPEDKVDIL-CTELAV---GKPITMRVHPKNGKD 752
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLnLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 85093919   753 FEVKLNHTFNDAQIEWFKNGSALNTM 778
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
49-778 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1329.89  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919    49 YKKMSENLAVVRSRLN-RPLTYAEKILYSHLDNPHE----QDIE--RGVSYLRLRPDRVACQDATAQMAILQFMSAGMPS 121
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   122 VANPTTVHCDHLIEAQVGGEKDLERAININKEVYDFLASACAKYNIGFWKPGSGIIHQIILENYAFPGGLLIGTDSHTPN 201
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   202 AAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSA 281
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   282 TGKATCGNMGAEIGATTSVFPYDKAMFDYLVATKRSDIAEFAKT--YQKE-LQADEGAEYDQHIEINLNELEPHINGPFT 358
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTgqYSFFkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   359 PDLATPISKFAQAAKENNWPEELKVGLIGSCTNSSYEDMTRAASIARDALDHGLKAKAAFVVTPGSEQIRATIARDGQLQ 438
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   439 TFEEFGGTVLANACGPCIGQWDRRDT-PKGTPNSILSSYNRNFTGRNDGNPATHSFVTSPDLVVAMSIAGSLYFNPLTDS 517
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDDvKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   518 LKDKDGKEFKLQAPTGAGLPDRGYDPGQNTYQAPPAD-RATVQVQVSPTSDRLQVLSPFNAWNGKDATDMPILIKAQGKT 596
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSpNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   597 TTDHISMAGPWLKYRGHLDNISNNMLIGAINAANGEANKVQNFtTGEWDAVPAVARDYKAKNIPWVVIGDWNYGEGSSRE 676
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   677 HAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDKISPEDKVDIL-CTELAV---GKPITMRVHPKNGKD 752
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLnLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 85093919   753 FEVKLNHTFNDAQIEWFKNGSALNTM 778
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
65-783 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 941.50  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   65 RPLTYAEKILYSHLDNPheqDIERGVSyLRLRPDRVACQDATAQMAILQFMSAGMPSVANPTTV-HCDHlieaqvggekD 143
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  144 LERAININKEVYDFLASACAKYNIGFWKPGSGIIHQIILENYAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMAN 223
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  224 LPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPY 303
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  304 DKAMFDYLVATKRSDIAEfaktyqkELQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFAqaakennwPEELKV 383
Cdd:PRK07229 227 DERTREFLKAQGREDDWV-------ELLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVA--------GIKVDQ 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  384 GLIGSCTNSSYEDMTRAASIARdalDHGLKAKAAFVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQwdrrD 463
Cdd:PRK07229 292 VLIGSCTNSSYEDLMRAASILK---GKKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM----G 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  464 TPKGTPNSILSSYNRNFTGRNdGNPATHSFVTSPDLVVAMSIAGSLYfNPLTdsLKDKDGKEFKLQAPTGAGLPDRGydp 543
Cdd:PRK07229 365 QAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRT--LALENGEYPKLEEPEGFAVDDAG--- 437
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  544 gqntYQAPPADRATVQVQVSPTSDRLQVLSPFnawngKDATDMPILIKAQGKTTTDHISMAGP-WLKYRGHLDNISNNML 622
Cdd:PRK07229 438 ----IIAPAEDGSDVEVVRGPNIKPLPLLEPL-----PDLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFVF 508
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  623 IGAINAANGEAnkvqnfttgewdavpavardykAKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETN 702
Cdd:PRK07229 509 EGVDNTFPERA----------------------KEQGGGIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKAN 566
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  703 LKKQGMLPLTFADPADYDKISPEDKVDIL-CTELAVGKPITMRVHpknGKDFEVKLNHTFNDAQIEWFKNGSALNTMAKN 781
Cdd:PRK07229 567 LINFGILPLTFADPADYDKIEEGDVLEIEdLREFLPGGPLTVVNV---TKDEEIEVRHTLSERQIEILLAGGALNLIKKK 643

                 ..
gi 85093919  782 AK 783
Cdd:PRK07229 644 LA 645
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
99-509 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134  Cd Length: 412  Bit Score: 812.44  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  99 RVACQDATAQMAILQFMSAGMPSVANPTTVHCDHLIEAQVGGEKDLERAININKEVYDFLASACAKYNIGFWKPGSGIIH 178
Cdd:cd01584   1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 179 QIILENYAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGI 258
Cdd:cd01584  81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 259 LTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYLVATKRSDIAEFAKTYQ-KELQADEGAE 337
Cdd:cd01584 161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKdDLLVADEGAE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 338 YDQHIEINLNELEPHINGPFTPDLATPISKFAQAAKENNWPEELKVGLIGSCTNSSYEDMTRAASIARDALDHGLKAKAA 417
Cdd:cd01584 241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 418 FVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQWDRRDTPKGTPNSILSSYNRNFTGRNDGNPATHSFVTSP 497
Cdd:cd01584 321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                       410
                ....*....|..
gi 85093919 498 DLVVAMSIAGSL 509
Cdd:cd01584 401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
33-784 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 779.20  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  33 DRKVKQNLLEEGNFINYKKmsENLAVVRSRLNRPLTYAEKILYSHLDNP------HEQDIERGV------SYLRLRPDRV 100
Cdd:COG1048   1 DSFKARKTLTVGGKTYYYY--DLPKLEESGKISKLPYSLKILLENLLRGedgteeHIEALARWLpsgkpeKEIAFRPARV 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 101 ACQDATAQMAilQFMSAGMPSVA-------------NPTTVHCDHLIEAQVGG-----EKDLERAININKEVYDFLASAC 162
Cdd:COG1048  79 VMQDFTGVPA--VVDLAAMRDAMvelggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLKWAA 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 163 -AKYNIGFWKPGSGIIHQIILENYAF-----PG----GLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPK 232
Cdd:COG1048 157 kAFYNFRVVPPGTGIIHQVNLEYLAKvvwakPGvaypDTLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPE 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 233 VIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYLV 312
Cdd:COG1048 237 VVGVKLTGKLPEGVTATDLVLTVTGMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLR 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 313 ATKRSDIA-EFAKTYQKE-----LQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFAQAAKENN---------- 376
Cdd:COG1048 317 LTGRSEEQvALVEAYAKAqglwyDPADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAENFEKILreieikrvys 396
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 377 ------WPEELKVGLIGSCTNSSYEDMTRAASI-ARDALDHGLKAKA--AFVVTPGSEQIRATIARDGQLQTFEEFGGTV 447
Cdd:COG1048 397 llgkelGDGKVVIAAITSCTNTSNPDVLIAAGLlAKKAVEKGLKVKPwvKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNI 476
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 448 LANACGPCIGQWDRRDTPKGTP---NSILS----SYNRNFTGRNdGNPATHSFVTSPDLVVAMSIAGSLYFNPLTDSLKD 520
Cdd:COG1048 477 VGYGCTTCIGNSGPLPEEIEKAindNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLGT 555
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 521 ----KDGKEFKLQAPTGAGLPDRGYDPGQNTYQAPPAD--------RATVQVQVSPTSDRLQVLSPFNAWNGKDA---TD 585
Cdd:COG1048 556 dndgKPVYLKDIWPSTEEIAEAVGKAVKPEMFRKEYADvfkwnaieVPEGPLYDWPNISTYIRLPPFFDGMGAEPkpiKG 635
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 586 MPILIKAQGKTTTDHISMAG--------PWLKYRGHLDNISNNMLIGAINAANGEANKV------------------QNF 639
Cdd:COG1048 636 ARVLAKLGDSITTDHISPAGsikadspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRGTfanirirnemvpgeggytIHQ 715
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 640 TTGE-WDAvpavARDYKAKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPAD 718
Cdd:COG1048 716 PSGEiYDA----AMKYKEEGIPLVVVAGKNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGET 791
                       810       820       830       840       850       860       870
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 719 YDKISPEDKVDILCTELAVGKP-ITMRVHPKNG---KDFEVKLNHTFNDAQIEWFKNGSALNTMAKNAKN 784
Cdd:COG1048 792 YDKLGLDGEETIDIGGLENLKPgATVTVTVTRGdgpVEEFPVLCRIDTAEEIEYYKAGGILNYVKRDLLK 861
Aconitase pfam00330
Aconitase family (aconitate hydratase);
71-507 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 395261  Cd Length: 458  Bit Score: 578.98  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919    71 EKILYSHLDNPHEQDIergvSYLrlrPDRVACQDATAQMAILQFMSAGM--------PSVAN---PTTVHCDHlieaqvG 139
Cdd:pfam00330   1 EKIWDAHLVEELDGSL----LYI---PDRVLLHDVTSPQAFVDLRAAGRavrrpggtPATIDhlvPTDLVIDR------D 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   140 GEKDLERAININKEVYDFLASACAKYNIGFWKPGSGIIHQIILEN-YAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAV 218
Cdd:pfam00330  68 LDKNIEDEISRNKEQYDFLEWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTTHGGLGALAFGVGGSEAE 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   219 DVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATT 298
Cdd:pfam00330 148 HVLATQPLEMKKPKVVGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGVRSLSMEGRATICNMAIEYGATA 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   299 SVFPYDKAMFDYLVATKRSDIAEFAKtYQKE-----LQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFAQAA- 372
Cdd:pfam00330 228 GLFPPDETTFEYLRATGRPEAPKGEA-YDKAvalwrLASDPGAVYDKVVEIDLSTIEPMVTGPTSPQDAVPLSELVPDPa 306
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   373 ------------------KENNWPEE---LKVGLIGSCTNSSYEDMTRAASIARDALDHGLKAKAA--FVVTPGSEQIRA 429
Cdd:pfam00330 307 faddvereaaeraleymgLEPGTPLEdgkVDIAFIGSCTNSSIEDLRAAAGLLKKAVEKGLKVAPGvkASVVPGSEVVRA 386
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 85093919   430 TIARDGQLQTFEEFGGTVLANACGPCIGQWDRrdTPKGtpNSILSSYNRNFTGRNdgNPATHSFVTSPDLVVAMSIAG 507
Cdd:pfam00330 387 YAEAEGLDKILEEAGFEWRGPGCSMCIGNSDR--LPPG--ERCVSSSNRNFEGRQ--GPGGRTHLASPALVAAAAIAG 458
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
49-778 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1329.89  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919    49 YKKMSENLAVVRSRLN-RPLTYAEKILYSHLDNPHE----QDIE--RGVSYLRLRPDRVACQDATAQMAILQFMSAGMPS 121
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   122 VANPTTVHCDHLIEAQVGGEKDLERAININKEVYDFLASACAKYNIGFWKPGSGIIHQIILENYAFPGGLLIGTDSHTPN 201
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   202 AAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSA 281
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   282 TGKATCGNMGAEIGATTSVFPYDKAMFDYLVATKRSDIAEFAKT--YQKE-LQADEGAEYDQHIEINLNELEPHINGPFT 358
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKTgqYSFFkLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   359 PDLATPISKFAQAAKENNWPEELKVGLIGSCTNSSYEDMTRAASIARDALDHGLKAKAAFVVTPGSEQIRATIARDGQLQ 438
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   439 TFEEFGGTVLANACGPCIGQWDRRDT-PKGTPNSILSSYNRNFTGRNDGNPATHSFVTSPDLVVAMSIAGSLYFNPLTDS 517
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDDvKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   518 LKDKDGKEFKLQAPTGAGLPDRGYDPGQNTYQAPPAD-RATVQVQVSPTSDRLQVLSPFNAWNGKDATDMPILIKAQGKT 596
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSpNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   597 TTDHISMAGPWLKYRGHLDNISNNMLIGAINAANGEANKVQNFtTGEWDAVPAVARDYKAKNIPWVVIGDWNYGEGSSRE 676
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   677 HAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDKISPEDKVDIL-CTELAV---GKPITMRVHPKNGKD 752
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLnLYEMLKnggGGEVDLRVTKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 85093919   753 FEVKLNHTFNDAQIEWFKNGSALNTM 778
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
65-783 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 941.50  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   65 RPLTYAEKILYSHLDNPheqDIERGVSyLRLRPDRVACQDATAQMAILQFMSAGMPSVANPTTV-HCDHlieaqvggekD 143
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  144 LERAININKEVYDFLASACAKYNIGFWKPGSGIIHQIILENYAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMAN 223
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  224 LPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPY 303
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  304 DKAMFDYLVATKRSDIAEfaktyqkELQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFAqaakennwPEELKV 383
Cdd:PRK07229 227 DERTREFLKAQGREDDWV-------ELLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVA--------GIKVDQ 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  384 GLIGSCTNSSYEDMTRAASIARdalDHGLKAKAAFVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQwdrrD 463
Cdd:PRK07229 292 VLIGSCTNSSYEDLMRAASILK---GKKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM----G 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  464 TPKGTPNSILSSYNRNFTGRNdGNPATHSFVTSPDLVVAMSIAGSLYfNPLTdsLKDKDGKEFKLQAPTGAGLPDRGydp 543
Cdd:PRK07229 365 QAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRT--LALENGEYPKLEEPEGFAVDDAG--- 437
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  544 gqntYQAPPADRATVQVQVSPTSDRLQVLSPFnawngKDATDMPILIKAQGKTTTDHISMAGP-WLKYRGHLDNISNNML 622
Cdd:PRK07229 438 ----IIAPAEDGSDVEVVRGPNIKPLPLLEPL-----PDLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFVF 508
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  623 IGAINAANGEAnkvqnfttgewdavpavardykAKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETN 702
Cdd:PRK07229 509 EGVDNTFPERA----------------------KEQGGGIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKAN 566
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  703 LKKQGMLPLTFADPADYDKISPEDKVDIL-CTELAVGKPITMRVHpknGKDFEVKLNHTFNDAQIEWFKNGSALNTMAKN 781
Cdd:PRK07229 567 LINFGILPLTFADPADYDKIEEGDVLEIEdLREFLPGGPLTVVNV---TKDEEIEVRHTLSERQIEILLAGGALNLIKKK 643

                 ..
gi 85093919  782 AK 783
Cdd:PRK07229 644 LA 645
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
99-509 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134  Cd Length: 412  Bit Score: 812.44  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  99 RVACQDATAQMAILQFMSAGMPSVANPTTVHCDHLIEAQVGGEKDLERAININKEVYDFLASACAKYNIGFWKPGSGIIH 178
Cdd:cd01584   1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 179 QIILENYAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGI 258
Cdd:cd01584  81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 259 LTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYLVATKRSDIAEFAKTYQ-KELQADEGAE 337
Cdd:cd01584 161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKdDLLVADEGAE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 338 YDQHIEINLNELEPHINGPFTPDLATPISKFAQAAKENNWPEELKVGLIGSCTNSSYEDMTRAASIARDALDHGLKAKAA 417
Cdd:cd01584 241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 418 FVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQWDRRDTPKGTPNSILSSYNRNFTGRNDGNPATHSFVTSP 497
Cdd:cd01584 321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                       410
                ....*....|..
gi 85093919 498 DLVVAMSIAGSL 509
Cdd:cd01584 401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
33-784 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 779.20  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  33 DRKVKQNLLEEGNFINYKKmsENLAVVRSRLNRPLTYAEKILYSHLDNP------HEQDIERGV------SYLRLRPDRV 100
Cdd:COG1048   1 DSFKARKTLTVGGKTYYYY--DLPKLEESGKISKLPYSLKILLENLLRGedgteeHIEALARWLpsgkpeKEIAFRPARV 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 101 ACQDATAQMAilQFMSAGMPSVA-------------NPTTVHCDHLIEAQVGG-----EKDLERAININKEVYDFLASAC 162
Cdd:COG1048  79 VMQDFTGVPA--VVDLAAMRDAMvelggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLKWAA 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 163 -AKYNIGFWKPGSGIIHQIILENYAF-----PG----GLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPK 232
Cdd:COG1048 157 kAFYNFRVVPPGTGIIHQVNLEYLAKvvwakPGvaypDTLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPE 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 233 VIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYLV 312
Cdd:COG1048 237 VVGVKLTGKLPEGVTATDLVLTVTGMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLR 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 313 ATKRSDIA-EFAKTYQKE-----LQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFAQAAKENN---------- 376
Cdd:COG1048 317 LTGRSEEQvALVEAYAKAqglwyDPADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAENFEKILreieikrvys 396
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 377 ------WPEELKVGLIGSCTNSSYEDMTRAASI-ARDALDHGLKAKA--AFVVTPGSEQIRATIARDGQLQTFEEFGGTV 447
Cdd:COG1048 397 llgkelGDGKVVIAAITSCTNTSNPDVLIAAGLlAKKAVEKGLKVKPwvKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNI 476
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 448 LANACGPCIGQWDRRDTPKGTP---NSILS----SYNRNFTGRNdGNPATHSFVTSPDLVVAMSIAGSLYFNPLTDSLKD 520
Cdd:COG1048 477 VGYGCTTCIGNSGPLPEEIEKAindNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLGT 555
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 521 ----KDGKEFKLQAPTGAGLPDRGYDPGQNTYQAPPAD--------RATVQVQVSPTSDRLQVLSPFNAWNGKDA---TD 585
Cdd:COG1048 556 dndgKPVYLKDIWPSTEEIAEAVGKAVKPEMFRKEYADvfkwnaieVPEGPLYDWPNISTYIRLPPFFDGMGAEPkpiKG 635
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 586 MPILIKAQGKTTTDHISMAG--------PWLKYRGHLDNISNNMLIGAINAANGEANKV------------------QNF 639
Cdd:COG1048 636 ARVLAKLGDSITTDHISPAGsikadspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRGTfanirirnemvpgeggytIHQ 715
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 640 TTGE-WDAvpavARDYKAKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPAD 718
Cdd:COG1048 716 PSGEiYDA----AMKYKEEGIPLVVVAGKNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGET 791
                       810       820       830       840       850       860       870
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 719 YDKISPEDKVDILCTELAVGKP-ITMRVHPKNG---KDFEVKLNHTFNDAQIEWFKNGSALNTMAKNAKN 784
Cdd:COG1048 792 YDKLGLDGEETIDIGGLENLKPgATVTVTVTRGdgpVEEFPVLCRIDTAEEIEYYKAGGILNYVKRDLLK 861
Aconitase pfam00330
Aconitase family (aconitate hydratase);
71-507 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 395261  Cd Length: 458  Bit Score: 578.98  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919    71 EKILYSHLDNPHEQDIergvSYLrlrPDRVACQDATAQMAILQFMSAGM--------PSVAN---PTTVHCDHlieaqvG 139
Cdd:pfam00330   1 EKIWDAHLVEELDGSL----LYI---PDRVLLHDVTSPQAFVDLRAAGRavrrpggtPATIDhlvPTDLVIDR------D 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   140 GEKDLERAININKEVYDFLASACAKYNIGFWKPGSGIIHQIILEN-YAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAV 218
Cdd:pfam00330  68 LDKNIEDEISRNKEQYDFLEWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTTHGGLGALAFGVGGSEAE 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   219 DVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATT 298
Cdd:pfam00330 148 HVLATQPLEMKKPKVVGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGVRSLSMEGRATICNMAIEYGATA 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   299 SVFPYDKAMFDYLVATKRSDIAEFAKtYQKE-----LQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFAQAA- 372
Cdd:pfam00330 228 GLFPPDETTFEYLRATGRPEAPKGEA-YDKAvalwrLASDPGAVYDKVVEIDLSTIEPMVTGPTSPQDAVPLSELVPDPa 306
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   373 ------------------KENNWPEE---LKVGLIGSCTNSSYEDMTRAASIARDALDHGLKAKAA--FVVTPGSEQIRA 429
Cdd:pfam00330 307 faddvereaaeraleymgLEPGTPLEdgkVDIAFIGSCTNSSIEDLRAAAGLLKKAVEKGLKVAPGvkASVVPGSEVVRA 386
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 85093919   430 TIARDGQLQTFEEFGGTVLANACGPCIGQWDRrdTPKGtpNSILSSYNRNFTGRNdgNPATHSFVTSPDLVVAMSIAG 507
Cdd:pfam00330 387 YAEAEGLDKILEEAGFEWRGPGCSMCIGNSDR--LPPG--ERCVSSSNRNFEGRQ--GPGGRTHLASPALVAAAAIAG 458
Aconitase cd01351
Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and ...
99-509 1.33e-137

Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Aconitase catalytic domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. Aconitase, in its active form, contains a 4Fe-4S iron-sulfur cluster; three cysteine residues have been shown to be ligands of the 4Fe-4S cluster. This is the Aconitase core domain, including structural domains 1, 2 and 3, which binds the Fe-S cluster. The aconitase family also contains the following proteins: - Iron-responsive element binding protein (IRE-BP), a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 153129  Cd Length: 389  Bit Score: 411.89  E-value: 1.33e-137
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  99 RVACQDATAQMAILQFMSAGMPS-VANPTTVHCDHLIEAQVGGEKDLERaininkevYDFLASACAKYNIGFWKPGSGII 177
Cdd:cd01351   1 RVMLQDATGPMAMKAFEILAALGkVADPSQIACVHDHAVQLEKPVNNEG--------HKFLSFFAALQGIAFYRPGVGII 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 178 HQIILENYAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAG 257
Cdd:cd01351  73 HQIMVENLALPGDLLVGSDSHTTSYGGLGAISTGAGGGDVAFVMAGGPAWLKKPEVVGVNLTGKLSPGVTGKDVVLKLGG 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 258 ILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYLVATKRSDIAEFAKTYQKELQADEGAE 337
Cdd:cd01351 153 IVGVDGVLNRIVEFYGEGVSSLSIEDRLTICNMMAELGATTGIFPEDKTTLKWLEATGRPLLKNLWLAFPEELLADEGAE 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 338 YDQHIEINLNELEPHINGPFTPDLATPISKFAQaakennwpEELKVGLIGSCTNSSYEDMTRAASIARDALdhgLKAKAA 417
Cdd:cd01351 233 YDQVIEIDLSELEPDISGPNRPDDAVSVSEVEG--------TKIDQVLIGSCTNNRYSDMLAAAKLLKGAK---VAPGVR 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 418 FVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQWDRRdtpKGTPNSILSSYNRNFTGRNdGNPATHSFVTSP 497
Cdd:cd01351 302 LIVTPGSRMVYATLSREGYYEILVDSGARILPPGCGPCMGNGARL---VADGEVGVSSGNRNFPGRL-GTYERHVYLASP 377
                       410
                ....*....|..
gi 85093919 498 DLVVAMSIAGSL 509
Cdd:cd01351 378 ELAAATAIAGKI 389
acon_putative TIGR01342
aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins ...
68-730 6.50e-132

aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins homologous (and likely functionally equivalent to) aconitase 1. Members are found, so far in the anaerobe Clostridium acetobutylicum, in the microaerophilic, early-branching bacterium Aquifex aeolicus, and in the halophilic archaeon Halobacterium sp. NRC-1. No member is experimentally characterized. [Energy metabolism, TCA cycle]


Pssm-ID: 130409 [Multi-domain]  Cd Length: 658  Bit Score: 406.68  E-value: 6.50e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919    68 TYAEKILYSHLdnpHEQDIERGvSYLRLRPDRVACQDATAQMAILQFMSAGMPSVANPTTV-HCDHLIEaqvggEKDLEr 146
Cdd:TIGR01342   1 TLAEKIIDDHL---VEGDLEPG-EEIAIEIDQTLSQDATGTMCWLEFEALEMDEVKTELAAqYCDHNML-----QFDFK- 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   147 ainiNKEVYDFLASACAKYNIGFWKPGSGIIHQIILENYAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPW 226
Cdd:TIGR01342  71 ----NADDHKFLMSAAGKFGAWFSKPGNGICHNVHKENFAAPGKTLLGSDSHTPTAGGLGMLAIGAGGIDIAAAMAGEAF 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   227 ELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKA 306
Cdd:TIGR01342 147 YLEMPEIVGVHLEGELPEWATAKDIILELLRRLSVKGGLGKIFEYFGEGVEELSVPERATITNMGAELGATSSIFPSDDI 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   307 MFDYLVATKRSDiaEFAktyqkELQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFAQaakennwpEELKVGLI 386
Cdd:TIGR01342 227 TEAWLAAFDRED--DFV-----DLLADADAEYADEIEIDLSDLEPLIAEPHMPDNVVPVREIAG--------IEVDQVMI 291
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   387 GSCTNSSYEDMTRAASI--ARDALDHglkakAAFVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQWDRRDT 464
Cdd:TIGR01342 292 GSCTNGAFEDLLPAAKLleGREVHKD-----TEFAVAPGSKQALELIAQEGALAEFLAAGANFLEAACGACIGIGFAPAS 366
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   465 pkgtpNSI-LSSYNRNFTGRNdGNPATHSFVTSPDLVVAMSIAGSLyFNPltDSLKDKDGkefKLQAPtGAGLPDR---G 540
Cdd:TIGR01342 367 -----DGVsLRSFNRNFEGRA-GIEDAKVYLASPETATAAAIAGEI-IDP--RDLADDEG---DLEAI-GFEMGEKfpgG 433
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   541 YDPGqNTYQAPPADRATVQVQVSPTSDRLQVLSPFNAwngkdATDMPILIKAQGKTTTDHISMAGP-WLKYRGHLDNISN 619
Cdd:TIGR01342 434 YDAA-DIDIIPKEEREDDDIIKGPNIKPLPEFDPLGA-----DIEGETALIMEDNITTDHIIPAGAdILKFRSNIEAISE 507
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   620 NMLigainaangeaNKVQnfttgewDAVPAVARDYKAKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIH 699
Cdd:TIGR01342 508 FTL-----------HRID-------DEFAERAKAADEKGKAGIIIAGENYGQGSSREHAALAPMFLGVEAVIAKSFARIH 569
                         650       660       670
                  ....*....|....*....|....*....|.
gi 85093919   700 ETNLKKQGMLPLTFADPADYDKISPEDKVDI 730
Cdd:TIGR01342 570 HANLFNFGILPLEFDNEEDYAKFELGDDIEI 600
AcnA_Bact cd01585
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
98-509 1.45e-114

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Bacterial Aconitase-like catalytic domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This distinct subfamily is found only in bacteria and Archaea. Its exact characteristics are not known.


Pssm-ID: 153135  Cd Length: 380  Bit Score: 352.14  E-value: 1.45e-114
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  98 DRVACQDATAQMAILQFMSAGMPSVANPTTV-HCDHLIeAQVGGEkdlerainiNKEVYDFLASACAKYNIGFWKPGSGI 176
Cdd:cd01585   1 DQTLTQDATGTMAYLQFEAMGVDRVRTELSVsYVDHNT-LQTDFE---------NADDHRFLQTVAARYGIYFSRPGNGI 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 177 IHQIILENYAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLA 256
Cdd:cd01585  71 CHQVHLERFAVPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYYIPMPKVVGVRLTGELPPWVTAKDVILELL 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 257 GILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYLVATKRSDiaEFAktyqkELQADEGA 336
Cdd:cd01585 151 RRLTVKGGVGKIFEYTGPGVATLSVPERATITNMGAELGATTSIFPSDERTREFLAAQGRED--DWV-----ELAADADA 223
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 337 EYDQHIEINLNELEPHINGPFTPDLATPISKFAQaakennwpeeLKVG--LIGSCTNSSYEDMTRAASIARDALDHglkA 414
Cdd:cd01585 224 EYDEEIEIDLSELEPLIARPHSPDNVVPVREVAG----------IKVDqvAIGSCTNSSYEDLMTVAAILKGRRVH---P 290
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 415 KAAFVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQwdrrDTPKGTPNSILSSYNRNFTGRNdGNPATHSFV 494
Cdd:cd01585 291 HVSMVVAPGSKQVLEMLARNGALADLLAAGARILESACGPCIGM----GQAPPTGGVSVRTFNRNFEGRS-GTKDDLVYL 365
                       410
                ....*....|....*
gi 85093919 495 TSPDLVVAMSIAGSL 509
Cdd:cd01585 366 ASPEVAAAAALTGVI 380
AcnA_Mitochon_Swivel cd01578
Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and ...
591-738 2.53e-101

Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 238810 [Multi-domain]  Cd Length: 149  Bit Score: 308.63  E-value: 2.53e-101
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 591 KAQGKTTTDHISMAGPWLKYRGHLDNISNNMLIGAINAANGEANKVQNFTTGEWDAVPAVARDYKAKNIPWVVIGDWNYG 670
Cdd:cd01578   1 KAKGKCTTDHISAAGPWLKYRGHLDNISNNLLIGAINAENGKANSVKNQVTGEYGPVPDTARDYKAHGIKWVVIGDENYG 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 85093919 671 EGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDKISPEDKVDILC-TELAVG 738
Cdd:cd01578  81 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYDKIHPDDKVDILGlTDFAPG 149
PRK09277 PRK09277
aconitate hydratase AcnA;
96-781 1.17e-85

aconitate hydratase AcnA;


Pssm-ID: 236445 [Multi-domain]  Cd Length: 888  Bit Score: 290.49  E-value: 1.17e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   96 RPDRVACQDATAQMAI--LqfmsAGM----------PSVANPTtVHC----DHLIEAQVGGEKD-LERAINI----NKEV 154
Cdd:PRK09277  83 RPARVVMQDFTGVPAVvdL----AAMrdaiadlggdPAKINPL-VPVdlviDHSVQVDYFGTPDaFEKNVELeferNEER 157
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  155 YDFLasacaKY------NIGFWKPGSGIIHQIILE-------------NYAFPGgLLIGTDSHTPNAAGLGMAAIGVGGA 215
Cdd:PRK09277 158 YQFL-----KWgqkafdNFRVVPPGTGICHQVNLEylapvvwtredgeLVAYPD-TLVGTDSHTTMINGLGVLGWGVGGI 231
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  216 DAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIG 295
Cdd:PRK09277 232 EAEAAMLGQPSSMLIPEVVGVKLTGKLPEGVTATDLVLTVTEMLRKKGVVGKFVEFFGEGLASLSLADRATIANMAPEYG 311
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  296 ATTSVFPYDKAMFDYLVATKRSD--IAeFAKTYQKE----LQADEGAEYDQHIEINLNELEPHINGP-------FTPDLA 362
Cdd:PRK09277 312 ATCGFFPIDEETLDYLRLTGRDEeqVA-LVEAYAKAqglwRDPLEEPVYTDVLELDLSTVEPSLAGPkrpqdriPLSDVK 390
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  363 TPISKFAQAAKENNWPEELKVGL-------------IGSCTNSSY-EDMTRAASIARDALDHGLKAKaAFVVT---PGSE 425
Cdd:PRK09277 391 EAFAKSAELGVQGFGLDEAEEGEdyelpdgavviaaITSCTNTSNpSVMIAAGLLAKKAVEKGLKVK-PWVKTslaPGSK 469
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  426 QIRATIARDGQLQTFEEFGGTVLANACGPCIGqwdrrdtpkgtpNS--------------------ILSSyNRNFTGRNd 485
Cdd:PRK09277 470 VVTDYLEKAGLLPYLEALGFNLVGYGCTTCIG------------NSgplppeiekaindndlvvtaVLSG-NRNFEGRI- 535
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  486 gNP-ATHSFVTSPDLVVAMSIAGSLYFNPLTDSL-KDKDGKE-------------------------FK----------- 527
Cdd:PRK09277 536 -HPlVKANYLASPPLVVAYALAGTVDIDLEKDPLgTDKDGNPvylkdiwpsdeeidavvakavkpemFRkeyadvfegde 614
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  528 ----LQAPTGAglpdrGYD-PGQNTY-QAPP-ADRATVQVQvsptsdrlqvlspfnawNGKDATDMPILIKAQGKTTTDH 600
Cdd:PRK09277 615 rwnaIEVPEGP-----LYDwDPDSTYiRNPPyFEGMLAEPG-----------------PVRDIKGARVLALLGDSITTDH 672
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  601 ISMAGP---------WLK-----------Y-----------RGHLDNIS--NNMLIGAinaangEANKVQNFTTGE---- 643
Cdd:PRK09277 673 ISPAGAikadspagkYLLehgvepkdfnsYgsrrgnhevmmRGTFANIRirNEMVPGV------EGGYTRHFPEGEvmsi 746
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  644 WDAvpavARDYKAKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYD--K 721
Cdd:PRK09277 747 YDA----AMKYKEEGTPLVVIAGKEYGTGSSRDWAAKGTRLLGVKAVIAESFERIHRSNLVGMGVLPLQFKPGESRKtlG 822
                        810       820       830       840       850       860
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 85093919  722 ISPEDKVDILCTE-LAVGKPITMRVHPKNG--KDFEVKLNhTFNDAQIEWFKNGSALNTMAKN 781
Cdd:PRK09277 823 LDGTETFDIEGLEdLKPGATVTVVITRADGevVEFPVLCR-IDTAVEVDYYRNGGILQYVLRD 884
acnA PRK12881
aconitate hydratase AcnA;
96-758 2.29e-84

aconitate hydratase AcnA;


Pssm-ID: 237246 [Multi-domain]  Cd Length: 889  Bit Score: 286.83  E-value: 2.29e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   96 RPDRVACQDATAQMAILQFmsAGM----------PSVANPTT---VHCDHLIEAQVGGEKD---LERAINI--NKEVYDF 157
Cdd:PRK12881  82 VPARVVMQDFTGVPALVDL--AAMrdaaaeaggdPAKINPLVpvdLVVDHSVAVDYFGQKDaldLNMKIEFqrNAERYQF 159
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  158 LASAC-AKYNIGFWKPGSGIIHQIILE--------------NYAFPGgLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMA 222
Cdd:PRK12881 160 LKWGMqAFDNFRVVPPGTGIMHQVNLEylarvvhtkeddgdTVAYPD-TLVGTDSHTTMINGIGVLGWGVGGIEAEAVML 238
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  223 NLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFP 302
Cdd:PRK12881 239 GQPVYMLIPDVVGVELTGKLREGVTATDLVLTVTEMLRKEGVVGKFVEFFGEGVASLTLGDRATIANMAPEYGATMGFFP 318
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  303 YDKAMFDYLVATKRSDIA-EFAKTYQKE--LQADEGAE--YDQHIEINLNELEPHINGP---------------FTPDLA 362
Cdd:PRK12881 319 VDEQTLDYLRLTGRTEAQiALVEAYAKAqgLWGDPKAEprYTRTLELDLSTVAPSLAGPkrpqdrialgnvksaFSDLFS 398
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  363 TPISKFAQAAKENNWPE-ELKVG-----LIGSCTNSSyeD---MTRAASIARDALDHGLKAKaAFVVT---PGSEQIRAT 430
Cdd:PRK12881 399 KPVAENGFAKKAQTSNGvDLPDGavaiaAITSCTNTS--NpsvLIAAGLLAKKAVERGLTVK-PWVKTslaPGSKVVTEY 475
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  431 IARDGQLQTFEEFGGTVLANACGPCIG-----------QWDRRDTpkgTPNSILSSyNRNFTGRNDGNpATHSFVTSPDL 499
Cdd:PRK12881 476 LERAGLLPYLEKLGFGIVGYGCTTCIGnsgpltpeieqAITKNDL---VAAAVLSG-NRNFEGRIHPN-IKANFLASPPL 550
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  500 VVAMSIAGSLYFNPLTDSL-KDKDGKEFKLQA--PTGAGLPD---RGYDPGQ---NTYQAPPADR--ATVQVQVSPTSDr 568
Cdd:PRK12881 551 VVAYALAGTVRRDLMTEPLgKGKDGRPVYLKDiwPSSAEIDAlvaFAVDPEDfrkNYAEVFKGSElwAAIEAPDGPLYD- 629
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  569 LQVLS------PFNAWNGKDATDMPILIKAQ------GKTTTDHIS---------MAGPWLKYRGHLDNISN-------- 619
Cdd:PRK12881 630 WDPKStyirrpPFFDFSMGPAASIATVKGARplavlgDSITTDHISpagaikadsPAGKYLKENGVPKADFNsygsrrgn 709
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  620 ---------------NMLIGAINAANgeankvqnfT----TGE----WDAvpavARDYKAKNIPWVVIGDWNYGEGSSRE 676
Cdd:PRK12881 710 hevmmrgtfanvrikNLMIPGKEGGL---------TlhqpSGEvlsiYDA----AMRYQAAGTPLVVIAGEEYGTGSSRD 776
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  677 HAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTF--ADPADYDKISPEDKVDI--LCTELAVGKPITMRVHPKNGKD 752
Cdd:PRK12881 777 WAAKGTRLLGVKAVIAESFERIHRSNLVGMGVLPLQFkgGDSRQSLGLTGGETFDIegLPGEIKPRQDVTLVIHRADGST 856

                 ....*.
gi 85093919  753 FEVKLN 758
Cdd:PRK12881 857 ERVPVL 862
IPMI cd01583
3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and ...
99-509 8.18e-80

3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate; Aconatase-like catalytic domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes.


Pssm-ID: 153133 [Multi-domain]  Cd Length: 382  Bit Score: 260.97  E-value: 8.18e-80
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  99 RVACQDATAQMAILQFMSAGMPSVANPTTVHC--DHLIEAqvggeKDLERAININKEVYDflasaCAKYNIGFWKPG-SG 175
Cdd:cd01583   1 LHLVHDVTSPQAFEGLREAGREKVWDPEKIVAvfDHNVPT-----PDIKAAEQVKTLRKF-----AKEFGINFFDVGrQG 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 176 IIHQIILENYAF-PGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILK 254
Cdd:cd01583  71 ICHVILPEKGLTlPGMTIVGGDSHTCTHGAFGAFATGIGTTDVAHVLATGKLWFRVPETMRVNVEGKLPPGVTAKDVILY 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 255 LAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYLvatkrsdiAEFAKTYQKELQADE 334
Cdd:cd01583 151 IIGKIGVDGATYKAMEFAGEAIESLSMEERMTLCNMAIEAGAKAGIVAPDETTFEYL--------KGRGKAYWKELKSDE 222
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 335 GAEYDQHIEINLNELEPHINGPFTPDLATPISKFAqaakennwPEELKVGLIGSCTNSSYEDMTRAASIARdalDHGLKA 414
Cdd:cd01583 223 DAEYDKVVEIDASELEPQVAWPHSPDNVVPVSEVE--------GIKIDQVFIGSCTNGRLEDLRAAAEILK---GRKVAD 291
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 415 KAAFVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGqwdrrdTPKGTPNS---ILSSYNRNFTGRNdGNPATH 491
Cdd:cd01583 292 GVRLIVVPASQRVYKQAEKEGLIEIFIEAGAEVRPPGCGACLG------GHMGVLAPgerCVSTSNRNFKGRM-GSPGAR 364
                       410
                ....*....|....*...
gi 85093919 492 SFVTSPDLVVAMSIAGSL 509
Cdd:cd01583 365 IYLASPATAAASAITGEI 382
PRK00402 PRK00402
3-isopropylmalate dehydratase large subunit; Reviewed
66-507 6.36e-78

3-isopropylmalate dehydratase large subunit; Reviewed


Pssm-ID: 234748  Cd Length: 418  Bit Score: 257.41  E-value: 6.36e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   66 PLTYAEKILYSHLDNPHEQ-DIergvsyLRLRPDRVACQDATAQMAILQFMSAGMPSVANPTTVH--CDHLIEAqvggeK 142
Cdd:PRK00402   2 GMTLAEKILARHSGRDVSPgDI------VEAKVDLVMAHDITGPLAIKEFEKIGGDKVFDPSKIVivFDHFVPA-----K 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  143 DLERAiNINKEVYDFLAsacaKYNI-GFWKPGSGIIHQIILEN-YAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDV 220
Cdd:PRK00402  71 DIKSA-EQQKILREFAK----EQGIpNFFDVGEGICHQVLPEKgLVRPGDVVVGADSHTCTYGALGAFATGMGSTDMAAA 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  221 MA---NlpWeLKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGAT 297
Cdd:PRK00402 146 MAtgkT--W-FKVPETIKVVLEGKLPPGVTAKDVILHIIGDIGVDGATYKALEFTGETIEALSMDERMTLANMAIEAGAK 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  298 TSVFPYDKAMFDYLvatkrsdiAEFAKTYQKELQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFaqaakennw 377
Cdd:PRK00402 223 AGIFAPDEKTLEYL--------KERAGRDYKPWKSDEDAEYEEVYEIDLSKLEPQVAAPHLPDNVKPVSEV--------- 285
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  378 pEELKV--GLIGSCTNSSYEDMTRAASIARDaldHGLKAKAAFVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGPC 455
Cdd:PRK00402 286 -EGTKVdqVFIGSCTNGRLEDLRIAAEILKG---RKVAPGVRLIVIPASQKIYLQALKEGLIEIFVDAGAVVSTPTCGPC 361
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 85093919  456 IGqwdrrdtpkG-----TPNS-ILSSYNRNFTGRNdGNPATHSFVTSPDLVVAMSIAG 507
Cdd:PRK00402 362 LG---------GhmgvlAPGEvCLSTTNRNFKGRM-GSPESEVYLASPAVAAASAVTG 409
LeuC COG0065
Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism] ...
65-507 2.78e-74

Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism];


Pssm-ID: 223143  Cd Length: 423  Bit Score: 247.88  E-value: 2.78e-74
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  65 RPLTYAEKILYSH----LDNPHEQDIergvsylrLRPDRVACQDATAQMAILQFMSAGMPsVANPTTVHC--DHLIEAqv 138
Cdd:COG0065   1 SAKTLYEKILDAHvgkeEVGAGETVL--------LYIDLHLVHDVTSPQAFEGLREAGRK-VRDPEKTVAtfDHNVPT-- 69
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 139 ggeKDLERAINInKEVYDFlasaCAKYNI-GFWKPGS-GIIHQIILEN-YAFPGGLLIGTDSHTPNAAGLGMAAIGVGGA 215
Cdd:COG0065  70 ---PDIKAAEQQ-KELREN----AKEFGIvNFYDVGDqGIVHQVGPEQgLTLPGMTIVGGDSHTCTHGAFGAFAFGIGTT 141
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 216 DAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIG 295
Cdd:COG0065 142 DVAHVLATGKLWFRVPKTMKVEVEGKLPPGVTAKDIILALIGKIGVDGGTGYAIEFAGEAIRSLSMEGRMTLCNMAIEAG 221
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 296 ATTSVFPYDKAMFDYLvatKRSDIAEfakTYQKELQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKfaqaaken 375
Cdd:COG0065 222 AKAGIIAPDETTFEYL---KEWDGAV---AYWKTLKSDEDAVYDKVVELDASDLEPQVAWPTNPDNVVPVSE-------- 287
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 376 NWPEELKVG--LIGSCTNSSYEDMTRAASIARdalDHGLKAKAAFVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACG 453
Cdd:COG0065 288 VEPDPIKIDqvFIGSCTNGRIEDLRAAAEILK---GRKVAPGVRAIVVPGSRRVKEQAEKEGLDKIFIEAGFEWREPGCG 364
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....
gi 85093919 454 PCIGQWDRRDTPKgtpNSILSSYNRNFTGRNdGNPATHSFVTSPDLVVAMSIAG 507
Cdd:COG0065 365 PCLGMHPGVLGPG---ERCASTSNRNFEGRQ-GSPGARTYLASPAMAAAAAVEG 414
PTZ00092 PTZ00092
aconitate hydratase-like protein; Provisional
22-776 2.14e-73

aconitate hydratase-like protein; Provisional


Pssm-ID: 240263 [Multi-domain]  Cd Length: 898  Bit Score: 256.86  E-value: 2.14e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   22 RCMATATENPLDrKVKQNLLEEGNFiNYKKMSEnlaVVRSRLNRpLTYAEKILYSHL----DN--PHEQDIERGVSY--- 92
Cdd:PTZ00092   6 LRMSSSRPNPFE-KVLKTLKDGGSY-KYYSLNE---LHDPRLKK-LPYSIRVLLESAvrncDEfdVTSKDVENILNWeen 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   93 ------LRLRPDRVACQDATAQMAILQF--------MSAGMPSVANP---TTVHCDHLIEAQVGG-----EKDLERAINI 150
Cdd:PTZ00092  80 skkqieIPFKPARVLLQDFTGVPAVVDLaamrdamkRLGGDPAKINPlvpVDLVIDHSVQVDFSRspdalELNQEIEFER 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  151 NKEVYDFL---ASACAKYNIgfWKPGSGIIHQIILE----------NYAFPGGLlIGTDSHTPNAAGLGMAAIGVGGADA 217
Cdd:PTZ00092 160 NLERFEFLkwgSKAFKNLLI--VPPGSGIVHQVNLEylarvvfnkdGLLYPDSV-VGTDSHTTMINGLGVLGWGVGGIEA 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  218 VDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGAT 297
Cdd:PTZ00092 237 EAVMLGQPISMVLPEVVGFKLTGKLSEHVTATDLVLTVTSMLRKRGVVGKFVEFYGPGVKTLSLADRATIANMAPEYGAT 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  298 TSVFPYDKAMFDYLVATKRSDIA-EFAKTYQKE--LQADEGA--EYDQHIEINLNELEPHINGP---------------F 357
Cdd:PTZ00092 317 MGFFPIDEKTLDYLKQTGRSEEKvELIEKYLKAngLFRTYAEqiEYSDVLELDLSTVVPSVAGPkrphdrvplsdlkkdF 396
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  358 TPDLATPISK--FAQAAKENNWPEELKV--------------GLIGSCTNSSYED-MTRAASIARDALDHGLKAkAAFVV 420
Cdd:PTZ00092 397 TACLSAPVGFkgFGIPEEKHEKKVKFTYkgkeytlthgsvviAAITSCTNTSNPSvMLAAGLLAKKAVEKGLKV-PPYIK 475
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  421 T---PGSEQIRATIARDGQLQTFEEFGGTVLANACGPCI---GQWDRRDTPKGTPN-----SILSSyNRNFTGRNdgNPA 489
Cdd:PTZ00092 476 TslsPGSKVVTKYLEASGLLKYLEKLGFYTAGYGCMTCIgnsGDLDPEVSEAITNNdlvaaAVLSG-NRNFEGRV--HPL 552
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  490 THS-FVTSPDLVVAMSIAGSLYFNPLTDSL-KDKDGKE-------------------------FK--------------- 527
Cdd:PTZ00092 553 TRAnYLASPPLVVAYALAGRVNIDFETEPLgSDKTGKPvflrdiwpsreeiqaleakyvkpemFKevysnitqgnkqwne 632
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  528 LQAPTGAGLPdrgYDPgQNTYQAPPADRATVQVQVSPTsdrlqvlspfnawngKDATDMPILIKAQGKTTTDHISMAG-- 605
Cdd:PTZ00092 633 LQVPKGKLYE---WDE-KSTYIHNPPFFQTMELEPPPI---------------KSIENAYCLLNLGDSITTDHISPAGni 693
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  606 ----PWLKY-------------------------RGHLDNIS-NNMLIGainaanGEANKVQNFTTGEWDAVPAVARDYK 655
Cdd:PTZ00092 694 aknsPAAKYlmergverkdfntygarrgndevmvRGTFANIRlINKLCG------KVGPNTVHVPTGEKMSIYDAAEKYK 767
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  656 AKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFAD--PADYDKISPEDK--VDIL 731
Cdd:PTZ00092 768 QEGVPLIVLAGKEYGSGSSRDWAAKGPYLQGVKAVIAESFERIHRSNLVGMGILPLQFLNgeNADSLGLTGKEQfsIDLN 847
                        890       900       910       920
                 ....*....|....*....|....*....|....*....|....*
gi 85093919  732 CTELAVGKPITMRVhpKNGKDFEVKLNHTfNDAQIEWFKNGSALN 776
Cdd:PTZ00092 848 SGELKPGQDVTVKT--DTGKTFDTILRID-TEVEVEYFKHGGILQ 889
PLN00070 PLN00070
aconitate hydratase
11-781 1.17e-66

aconitate hydratase


Pssm-ID: 215047 [Multi-domain]  Cd Length: 936  Bit Score: 238.55  E-value: 1.17e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   11 ARSRAAAGLGRRCMATATENPLDRKVKQnlLEE---GNFINYKKMSenlAVVRSRLNRpLTYAEKILYS----HLDNPH- 82
Cdd:PLN00070  24 AASPVIERFQRKFASMASENPFKGILTS--LPKpggGEFGKYYSLP---ALNDPRIDK-LPYSIRILLEsairNCDNFQv 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   83 -EQDIERGVSY---------LRLRPDRVACQDATAQMAI--LQFMSAGM------PSVANP---TTVHCDHLIEAQVGG- 140
Cdd:PLN00070  98 tKEDVEKIIDWentspkqveIPFKPARVLLQDFTGVPAVvdLACMRDAMnnlggdPNKINPlvpVDLVIDHSVQVDVARs 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  141 ----EKDLERAININKEVYDFLA-SACAKYNIGFWKPGSGIIHQIILENYA---F-PGGLL-----IGTDSHTPNAAGLG 206
Cdd:PLN00070 178 enavQANMELEFQRNKERFAFLKwGSTAFQNMLVVPPGSGIVHQVNLEYLGrvvFnTDGILypdsvVGTDSHTTMIDGLG 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  207 MAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKAT 286
Cdd:PLN00070 258 VAGWGVGGIEAEAAMLGQPMSMVLPGVVGFKLSGKLRDGVTATDLVLTVTQMLRKHGVVGKFVEFYGEGMSELSLADRAT 337
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  287 CGNMGAEIGATTSVFPYDKAMFDYLVATKRSDiaEFAKTYQKELQAD----------EGAEYDQHIEINLNELEPHINGP 356
Cdd:PLN00070 338 IANMSPEYGATMGFFPVDHVTLQYLKLTGRSD--ETVAMIEAYLRANkmfvdynepqQERVYSSYLELDLEDVEPCISGP 415
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  357 FTP------------------------DLATPISKFAQAAK--ENNWPEELKVG-----LIGSCTNSSYED-MTRAASIA 404
Cdd:PLN00070 416 KRPhdrvplkemkadwhscldnkvgfkGFAVPKEAQSKVAKfsFHGQPAELRHGsvviaAITSCTNTSNPSvMLGAGLVA 495
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  405 RDALDHGLKAKaAFVVT---PGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQWDRRDTPKG---TPNSILS---- 474
Cdd:PLN00070 496 KKACELGLEVK-PWIKTslaPGSGVVTKYLLKSGLQKYLNQQGFHIVGYGCTTCIGNSGELDESVAsaiTENDIVAaavl 574
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  475 SYNRNFTGRNdgNPATHS-FVTSPDLVVAMSIAGSLYFNPLTDSL-KDKDGKE--FKLQAPTG---------AGLPD--- 538
Cdd:PLN00070 575 SGNRNFEGRV--HPLTRAnYLASPPLVVAYALAGTVDIDFEKEPIgTGKDGKDvfFRDIWPSNeevaevvqsSVLPDmfk 652
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  539 -------RGyDPGQNTYQAPpadrATVQVQVSPTSDRLQ--------VLSPFNAWNGKDATdmpILIKAQGKTTTDHISM 603
Cdd:PLN00070 653 styeaitKG-NPMWNQLSVP----SGTLYSWDPKSTYIHeppyfknmTMSPPGPHGVKDAY---CLLNFGDSITTDHISP 724
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  604 AG------PWLKY-------------------------RGHLDNIS--NNMLigainaaNGEAN-KVQNFTTGEWDAVPA 649
Cdd:PLN00070 725 AGsihkdsPAAKYlmergvdrkdfnsygsrrgndeimaRGTFANIRivNKLL-------KGEVGpKTVHIPTGEKLSVFD 797
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  650 VARDYKAKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDK--ISPEDK 727
Cdd:PLN00070 798 AAMKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTlgLTGHER 877
                        890       900       910       920       930
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 85093919  728 VDI-LCTELAVGKP-ITMRVHPKNGKDFEVKLNHtfnDAQIE--WFKNGSALNTMAKN 781
Cdd:PLN00070 878 YTIdLPSNISEIKPgQDVTVTTDNGKSFTCTLRF---DTEVElaYFDHGGILPYVIRN 932
AcnA_IRP cd01586
Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA ...
99-508 2.93e-53

Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydrolyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes.


Pssm-ID: 153136  Cd Length: 404  Bit Score: 189.82  E-value: 2.93e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  99 RVACQDATAQMAILQFMS--------AGMPSVAN---PTTVHCDHLIEAQVGG-----EKDLERAININKEVYDFL-ASA 161
Cdd:cd01586   1 RVILQDFTGVPAVVDLAAmrdavkrlGGDPEKINpliPVDLVIDHSVQVDFYGtadalAKNMKLEFERNRERYEFLkWGQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 162 CAKYNIGFWKPGSGIIHQIILE--------------NYAFPGGLlIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWE 227
Cdd:cd01586  81 KAFKNLRVVPPGTGIIHQVNLEylarvvftseedgdGVAYPDSV-VGTDSHTTMINGLGVLGWGVGGIEAEAVMLGQPIS 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 228 LKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDkam 307
Cdd:cd01586 160 MLLPEVVGVKLTGKLRPGVTATDLVLTVTQMLRKVGVVGKFVEFFGPGVAKLSVADRATIANMAPEYGATCGFFPVD--- 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 308 fdylvatkrsdiaefaktyqkelqadegaeyDQHIEINLNELEPHINGPFTPDLATPI-SKFAQAAkennwpeelkvglI 386
Cdd:cd01586 237 -------------------------------TQVVELDLSTVEPSVSGPKRPQDRVPLhGSVVIAA-------------I 272
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 387 GSCTNSSYED-MTRAASIARDALDHGLKAKaAFVVT---PGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGqwDRR 462
Cdd:cd01586 273 TSCTNTSNPSvMLAAGLLAKKAVELGLKVK-PYVKTslaPGSRVVTKYLEASGLLPYLEKLGFHVVGYGCTTCIG--NSG 349
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 85093919 463 DTPKGTPNSI----------LSSyNRNFTGRNdgNPATHS-FVTSPDLVVAMSIAGS 508
Cdd:cd01586 350 PLPEEVEEAIkendlvvaavLSG-NRNFEGRI--HPLVRAnYLASPPLVVAYALAGT 403
Aconitase_C pfam00694
Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This ...
586-716 9.39e-52

Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This domain undergoes conformational change in the enzyme mechanism.


Pssm-ID: 395564 [Multi-domain]  Cd Length: 131  Bit Score: 176.40  E-value: 9.39e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   586 MPILIKAQGKTTTDHISMAGPWLKYRGHLDNISNNMLIGAINAANGEANKVQNFTTGEWDAVPAVARDYKAKNIPWVVIG 665
Cdd:pfam00694   1 MARFLTLKGLTTPDFNSNVDTDLIIPKQFLGTIANIGIGNINFEGWRAGKTTHLPDGENPDFYDAAERYKQHGAPIVVIA 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 85093919   666 DWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADP 716
Cdd:pfam00694  81 GKNYGCGSSREHAAWALRDLGIKAVIAESFARIHRNNLIKNGLLPLEFPRE 131
h_aconitase TIGR00139
homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is ...
66-711 5.79e-47

homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is part of an unusual lysine biosynthesis pathway. Because this model is based on just two sequences from a narrow taxonomic range, it may not recognize distant orthologs, should any exist. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures, but 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble leuC and leuD over their lengths but are even closer to the respective domains of homoaconitase, and their identity is uncertain. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 129245 [Multi-domain]  Cd Length: 712  Bit Score: 178.70  E-value: 5.79e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919    66 PLTYAEKILYSHLDNPHEQDIERGVSYLRLRPDRVACQDATAQMAiLQFMSAGMPSVANPTTV--HCDHliEAQVGGEKD 143
Cdd:TIGR00139   1 GQNLTEKIVQKYAVGLPEGKFVHSGDYVSIKPAHCMSHDNSWPCA-LKFMGIGASKIHNPDQIvmTLDH--DIQNKSDKN 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   144 LERAININkevyDFlasaCAKYNIGFWKPGSGIIHQIILEN-YAFPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMA 222
Cdd:TIGR00139  78 LKKYKNIE----EF----AKKHGIDFYPAGRGIGHQIMIEEgFAFPGNLAVASDSHSNMYGGLGCLGTPIVRTDAAAIWA 149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   223 NLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYG--EGASSMSATGKATCGNMGAEIGATTSV 300
Cdd:TIGR00139 150 TGKTWWQIPPVAKVEFKGQLPPGVSGKDIIVALCGLFNKDDVLNHAIEFTGseDSLNALPIDHRLTIANMTTEWGALSGL 229
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   301 FPYDKAMFDYLV------------------ATKRSDIAEFAKTYQKELQADEGAEYDQHIEINLNELEPHINGPFTPDLA 362
Cdd:TIGR00139 230 FPIDKTLIDWLKgkatlaalgladgpfinpAAERFTHPALEEKAEIPLKADKDAHYAKELFIDLASLSHYVSGPNSVKVA 309
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   363 TPISKFAQaakennwpEELKV--GLIGSCTNSSYEDMTRAASIARDALD-HGLKAK-----AAFVVTPGSEQIRATIARD 434
Cdd:TIGR00139 310 NPLKDLEA--------QDIKIdkAYLVSCTNSRASDIAAAADVFCEAADkNGGKINkiapgVEFYIAAASIEEEAAAEGN 381
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   435 GQLQTFEEFGGTVLANACGPCIGQWDRRDTPKGTPnsiLSSYNRNFTGRNdGNPATHSFVTSPDLVVAMSIAGSLyfnpl 514
Cdd:TIGR00139 382 GAWEKLLEAGAIPLPAGCGPCIGLGAGLLEPGEVG---ISASNRNFKGRM-GSKDAKAYLASPAVVAASALLGKI----- 452
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   515 tDSLKDKDGKEFKLQAPTGAGLPDRGYDPGQNTYQAPPADRATVQVQVSPTSDRLQVLSPFNAWNGKDATDMpilikaqg 594
Cdd:TIGR00139 453 -SGPAEVLSPEGWTEIIFGEGDGIKEEDRMLTNEEALEKIIGIIDDLVADEEKNAASEAPAQEESEQGLTEI-------- 523
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   595 ktttdhismagpwlkYRGHLDNISNNMLIGAINAANGEANKVQNFTTGewDAVP--AVAR--------DYKAKNIPW-VV 663
Cdd:TIGR00139 524 ---------------LEGFPEEFSGELVFCDADNINTDGIYPGKYTYQ--DDVPkeKMAQvcmenydaEFRTKAHEGdIL 586
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|....*...
gi 85093919   664 IGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPL 711
Cdd:TIGR00139 587 VSGFNFGCGSSREQAATAILAKGINLVVSGSFGNIFSRNSINNALLGL 634
Homoaconitase cd01582
Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase ...
111-509 4.60e-39

Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase catalytic domain. Homoaconitase and other uncharacterized proteins of the Aconitase family. Homoaconitase is part of an unusual lysine biosynthesis pathway found only in filamentous fungi, in which lysine is synthesized via the alpha-aminoadipate pathway. In this pathway, homoaconitase catalyzes the conversion of cis-homoaconitic acid into homoisocitric acid. The reaction mechanism is believed to be similar to that of other aconitases.


Pssm-ID: 153132  Cd Length: 363  Bit Score: 148.53  E-value: 4.60e-39
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 111 ILQFMSAGMPSVANPTTVHC--DHliEAQVGGEKDLERAININkevydflaSACAKYNIGFWKPGSGIIHQIILEN-YAF 187
Cdd:cd01582  12 ALKFMSIGATKIHNPDQIVMtlDH--DVQNKSEKNLKKYKNIE--------SFAKKHGIDFYPAGRGIGHQIMIEEgYAF 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 188 PGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGS 267
Cdd:cd01582  82 PGTLAVASDSHSNMYGGVGCLGTPIVRTDAAAIWATGQTWWQIPPVAKVELKGQLPKGVTGKDVIVALCGLFNKDQVLNH 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 268 IVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKamfdylvatkrsdiaefaktyqkelqadegaeydQHIEINLN 347
Cdd:cd01582 162 AIEFTGSGLNSLSVDTRLTIANMTTEWGALSGLFPTDA----------------------------------KHLILDLS 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 348 ELEPHINGPFTPDLATPISKFAQAAKENNwpeelKVGLIgSCTNSSYEDMTRAASIARDALDHGLKAKAA----FVVTPG 423
Cdd:cd01582 208 TLSPYVSGPNSVKVSTPLKELEAQNIKIN-----KAYLV-SCTNSRASDIAAAADVVKGKKEKNGKIPVApgveFYVAAA 281
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 424 SEQIRATIARDGQLQTFEEFGGTVLANACGPCI--GQWDRRDTPKGtpnsiLSSYNRNFTGRNdGNPATHSFVTSPDLVV 501
Cdd:cd01582 282 SSEVQAAAEKNGDWQTLLEAGATPLPAGCGPCIglGQGLLEPGEVG-----ISATNRNFKGRM-GSTEALAYLASPAVVA 355

                ....*...
gi 85093919 502 AMSIAGSL 509
Cdd:cd01582 356 ASAISGKI 363
PRK05478 PRK05478
3-isopropylmalate dehydratase large subunit;
158-507 6.00e-38

3-isopropylmalate dehydratase large subunit;


Pssm-ID: 235490  Cd Length: 466  Bit Score: 147.96  E-value: 6.00e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  158 LASACAKYNIGFWKPGS---GIIHQIILENYA-FPGGLLIGTDSHTPNAAGLGMAAIGVGGADAVDVMAN--LPweLKAP 231
Cdd:PRK05478  86 LEKNCKEFGITLFDLGDprqGIVHVVGPEQGLtLPGMTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATqtLL--QKKP 163
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  232 KVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYL 311
Cdd:PRK05478 164 KTMKIEVDGKLPPGVTAKDIILAIIGKIGTAGGTGYVIEFAGEAIRALSMEGRMTICNMSIEAGARAGLVAPDETTFEYL 243
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  312 VATKRS-DIAEF--AKTYQKELQADEGAEYDQHIEINLNELEPHINGPFTPDLATPIS-------KFAQAAKENNWPEEL 381
Cdd:PRK05478 244 KGRPFApKGEDWdkAVAYWKTLKSDEDAVFDKVVTLDAADIEPQVTWGTNPGQVISIDgkvpdpeDFADPVKRASAERAL 323
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  382 K-VGL---------------IGSCTNSSYEDMTRAASIARDaldhglKAKA----AFVVtPGSEQIRATIARDGQLQTFE 441
Cdd:PRK05478 324 AyMGLkpgtpitdikidkvfIGSCTNSRIEDLRAAAAVVKG------RKVApgvrALVV-PGSGLVKAQAEAEGLDKIFI 396
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 85093919  442 EFG------GtvlanaCGPCIGQWDrrDTPKGTPNSIlSSYNRNFTGRNDGNPATHsfVTSPDLVVAMSIAG 507
Cdd:PRK05478 397 EAGfewrepG------CSMCLAMNP--DKLPPGERCA-STSNRNFEGRQGKGGRTH--LVSPAMAAAAAITG 457
PRK12466 PRK12466
3-isopropylmalate dehydratase large subunit;
121-509 1.24e-37

3-isopropylmalate dehydratase large subunit;


Pssm-ID: 183543  Cd Length: 471  Bit Score: 146.97  E-value: 1.24e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  121 SVANPTTVHC--DHLIEAQVGGekDLERAININKEVYDFLASACAKYNI---GFWKPGSGIIHQIILE-NYAFPGGLLIG 194
Cdd:PRK12466  51 TVRRPDLTLAvvDHVVPTRPGR--DRGITDPGGALQVDYLRENCADFGIrlfDVDDPRQGIVHVVAPElGLTLPGMVIVC 128
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  195 TDSHTPNAAGLGMAAIGVGGADAVDVMANLPWELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIVEYYGE 274
Cdd:PRK12466 129 GDSHTTTYGALGALAFGIGTSEVEHVLATQTLVYRKPKTMRVRVDGELPPGVTAKDLILALIARIGADGATGYAIEFAGE 208
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  275 GASSMSATGKATCGNMGAEIGATTSVFPYDKAMFDYLVATKRS---DIAEFAKTYQKELQADEGAEYDQHIEINLNELEP 351
Cdd:PRK12466 209 AIRALSMEGRMTLCNMAVEAGARGGLIAPDETTFDYLRGRPRApkgALWDAALAYWRTLRSDADAVFDREVEIDAADIAP 288
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  352 HINGPFTPDLATPIS-------KFAQAAKENNWPEELK-VGL---------------IGSCTNSSYEDMTRAASIARdal 408
Cdd:PRK12466 289 QVTWGTSPDQAVPITgrvpdpaAEADPARRAAMERALDyMGLtpgtplagipidrvfIGSCTNGRIEDLRAAAAVLR--- 365
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  409 dhGLKAKA---AFVVtPGSEQIRATIARDGQLQTFEEFGGTVLANACGPCIGQWDRRDTPkGTpnSILSSYNRNFTGRND 485
Cdd:PRK12466 366 --GRKVAPgvrAMVV-PGSGAVRRQAEAEGLARIFIAAGFEWREPGCSMCLAMNDDVLAP-GE--RCASTTNRNFEGRQG 439
                        410       420
                 ....*....|....*....|....
gi 85093919  486 GNPATHsfVTSPDLVVAMSIAGSL 509
Cdd:PRK12466 440 PGARTH--LMSPAMVAAAAVAGHI 461
PRK11413 PRK11413
putative hydratase; Provisional
68-721 3.69e-32

putative hydratase; Provisional


Pssm-ID: 183125 [Multi-domain]  Cd Length: 751  Bit Score: 133.60  E-value: 3.69e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   68 TYAEKILYSHLDNPHEQDiergvsyLRLRPDRVACQDATAqMAILQFMSA-GMPSVANPTTVHCDHLIEAQVGGekdler 146
Cdd:PRK11413  36 TIAWSILSSHNTSGNMDK-------LKIKFDSLASHDITF-VGIIQTAKAsGMERFPLPYVLTNCHNSLCAVGG------ 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  147 aiNINKEVYDFLASACAKYNIGFWKPGSGIIHQIILENYAFPGGLLIGTDSHTPNAAgLGMAAIGVGGADAVDVMANLPW 226
Cdd:PRK11413 102 --TINEDDHVFGLSAAQKYGGIFVPPHIAVIHQYMREMMAGGGKMILGSDSHTRYGA-LGTMAVGEGGGELVKQLLNDTY 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  227 ELKAPKVIGVKLTGALNGWTTPKDVILKLAGILTVKGGTGSIV-EYYGEGASSMSATGKATCGNMGAEIGATTSVFPYDK 305
Cdd:PRK11413 179 DIDYPGVVAVYLTGKPAPGVGPQDVALAIIGAVFKNGYVKNKVmEFVGPGVSALSTDFRNGVDVMTTETTCLSSIWQTDE 258
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  306 AMFDYLvatkrsDIAEFAKTYqKELQADEGAEYDQHIEINLNELEPHINGPFTPDLATPISKFAQAAKE----------- 374
Cdd:PRK11413 259 EVHNWL------ALHGRGQDY-CELNPQPMAYYDGCISVDLSAIKPMIALPFHPSNVYEIDELNQNLTDilreveieser 331
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  375 --NNWPE----------ELKV--GLIGSCTNSSYEDMTRAASIardaldhgLKAKA------AFVVTPGSEQIRATIARD 434
Cdd:PRK11413 332 vaHGKAKlslldkiengRLKVqqGIIAGCSGGNYENVIAAANA--------LRGQScgndtfSLSVYPSSQPVFMDLAKK 403
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  435 GQLQTFEEFGGTVLANACGPCIGQwdrRDTPKGTPNSILSSyNRNFTGRNDGNPATHSfVTSPDLVVAMSIAGSLYFNPL 514
Cdd:PRK11413 404 GVVADLMGAGAIIRTAFCGPCFGA---GDTPANNGLSIRHT-TRNFPNREGSKPANGQ-MSAVALMDARSIAATAANGGY 478
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  515 TDSLKDKDGKEFKlqaptgaglPDRGYDPGqntyqapPADRATVQVQVSPTSDRLQVLSPfnawNGKDATDMP-----IL 589
Cdd:PRK11413 479 LTSATELDCWDNV---------PEYAFDVT-------PYKNRVYQGFGKGATQQPLIYGP----NIKDWPEMGaltdnIL 538
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  590 IKAQGK-----TTTDHISMAGPWLKYRghldniSNNMLIGAINAAN------GEANKVQNFT----TGEWDAVPAV-ARD 653
Cdd:PRK11413 539 LKVCSKildpvTTTDELIPSGETSSYR------SNPLGLAEFTLSRrdpgyvGRSKAVAELEnqrlAGNVSELTEVfARI 612
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 85093919  654 YKAKNIPWVV-----IGDWNY----GEGSSREHAALEPRHLGGLAIITRSFA-RIHETNLKKQGMLPLTFADPADYDK 721
Cdd:PRK11413 613 KQIAGQEHIDplqteIGSMVYavkpGDGSAREQAASCQRVLGGLANIAEEYAtKRYRSNVINWGMLPFQMAEEPTFEV 690
AcnA_Bact_Swivel cd01579
Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) ...
591-730 2.10e-27

Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism. This distinct subfamily is found only in bacteria and archea. Its exact characteristics are not known.


Pssm-ID: 238811 [Multi-domain]  Cd Length: 121  Bit Score: 107.14  E-value: 2.10e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 591 KAQGKTTTDHISMAGP-WLKYRGHLDNISNnmligainaangeankvqnFTTGEWDavPAVARDYKAKNiPWVVIGDWNY 669
Cdd:cd01579   1 KVGDNITTDHIMPAGAkVLPLRSNIPAISE-------------------FVFHRVD--PTFAERAKAAG-PGFIVGGENY 58
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 85093919 670 GEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDKISPEDKVDI 730
Cdd:cd01579  59 GQGSSREHAALAPMYLGVRAVLAKSFARIHRANLINFGILPLTFADEDDYDRFEQGDQLEL 119
Aconitase_swivel cd00404
Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible ...
660-730 3.12e-25

Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. The aconitase family contains the following proteins: - Iron-responsive element binding protein (IRE-BP). IRE-BP is a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 238236 [Multi-domain]  Cd Length: 88  Bit Score: 99.85  E-value: 3.12e-25
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 85093919 660 PWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDKISPEDKVDI 730
Cdd:cd00404  16 PGVVIGDENYGTGSSREHAALELRLLGGRAVIAKSFARIFFRNLVDQGLLPLEFADPEDYLKLHTGDELDI 86
AcnA_IRP_Swivel cd01580
Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, ...
595-731 1.72e-19

Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238812 [Multi-domain]  Cd Length: 171  Bit Score: 86.18  E-value: 1.72e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 595 KTTTDHISMAG------PWLKY-------------------------RGHLDNISN-NMLIGainaaNGEANKVQNFTTG 642
Cdd:cd01580   5 SVTTDHISPAGsiakdsPAGKYlaergvkprdfnsygsrrgndevmmRGTFANIRLrNKLVP-----GTEGGTTHHPPTG 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 643 EWDAVPAVARDYKAKNIPWVVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADP--ADYD 720
Cdd:cd01580  80 EVMSIYDAAMRYKEEGVPLVILAGKEYGSGSSRDWAAKGPFLLGVKAVIAESFERIHRSNLVGMGILPLQFPPGenADSL 159
                       170
                ....*....|.
gi 85093919 721 KISPEDKVDIL 731
Cdd:cd01580 160 GLTGEETYDII 170
AcnB COG1049
Aconitase B [Energy production and conversion];
171-509 1.50e-12

Aconitase B [Energy production and conversion];


Pssm-ID: 223978 [Multi-domain]  Cd Length: 852  Bit Score: 71.32  E-value: 1.50e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 171 KPGSGIIHQIiLENYAFPGGLLIGTDSHT--------PnaAGLGMAAIgvggADAVDVMAnlpweLKAPKVIGVKLTGAL 242
Cdd:COG1049 464 RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfpigisfP--AGSGLVAF----AAATGVMP-----LDMPESVLVRFKGEM 531
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 243 NGWTTPKDVI-------LKlAGILTVKGG------TGSIVEYygEGASSMSATGKATCGNMGAEIGATTSVFPYDKA-MF 308
Cdd:COG1049 532 QPGITLRDLVhaipyyaIK-QGLLTVEKKgkknifSGRILEI--EGLPDLKVEQAFELTDASAERSAAGCTIKLNKEpII 608
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 309 DYLvatkRSDIAEF----AKTYQKE-------------------LQADEGAEYDQHIEINLNEL-EPHINGPFTPDLATP 364
Cdd:COG1049 609 EYL----KSNIVLLkwmiAEGYGDArtlerridkmeawlanpelLEADADAEYAAVIEIDLADIkEPILAAPNDPDDVRL 684
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 365 ISKFAQaakennwpEELKVGLIGSCtnssyedMT-----RAAsiARDALDHGLKAKAAFVVTPGSEQIRATIARDGQLQT 439
Cdd:COG1049 685 LSEVAG--------DKIDEVFIGSC-------MTnighfRAA--GKLLENAKGELPTRLWVAPPTKMDAAQLTEEGYYSI 747
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 440 FEEFGGTVLANACGPCIGQWDRrdTPKGTpnSILSSYNRNFTGRNDGNpaTHSFVTSPDLVVAMSIAGSL 509
Cdd:COG1049 748 FGKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRLGKG--ANVYLASAELAAVCAILGKI 811
AcnB cd01581
Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA ...
171-509 1.71e-11

Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle; Aconitase B catalytic domain. Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle. Aconitase has an active (4FE-4S) and an inactive (3FE-4S) form. The active cluster is part of the catalytic site that interconverts citrate, cis-aconitase and isocitrate. The domain architecture of aconitase B is different from other aconitases in that the catalytic domain is normally found at C-terminus for other aconitases, but it is at N-terminus for B family. It also has a HEAT domain before domain 4 which plays a role in protein-protein interaction. This alignment is the core domain including domains 1,2 and 3.


Pssm-ID: 153131  Cd Length: 436  Bit Score: 67.14  E-value: 1.71e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 171 KPGSGIIHQIiLENYAFPGGLLIGTDSHTPNAAGLGMAAIG--VGGADAVDVMAnlpweLKAPKVIGVKLTGALNGWTTP 248
Cdd:cd01581  90 RPGDGVIHSW-LNRMLLPDTVGTGGDSHTRFPIGISFPAGSglVAFAAATGVMP-----LDMPESVLVRFKGKMQPGITL 163
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 249 KDVILKL------AGILTV--KGG----TGSIVEYygEGASSMSATGKATCGNMGAEIGATTSVFPYDKA-MFDYL-VAT 314
Cdd:cd01581 164 RDLVNAIpyyaiqQGLLTVekKGKknvfNGRILEI--EGLPDLKVEQAFELTDASAERSAAACTVRLDKEpVIEYLeSNV 241
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 315 KRSDIA-----EFAKTYQKE-------------LQADEGAEYDQHIEINLNEL-EPHINGPFTPDLATPISKFAQAAken 375
Cdd:cd01581 242 VLMKIMiangyDDARTLLRRiiameewlanpplLEPDADAEYAAVIEIDLDDIkEPILACPNDPDDVKLLSEVAGKK--- 318
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 376 nwpeeLKVGLIGSC-TNSSyeDMTRAASIARDALDhglkAKAAFVVTPGSEQIRATIARDGQLQTFEEFGGTVLANACGP 454
Cdd:cd01581 319 -----IDEVFIGSCmTNIG--HFRAAAKILRGKEF----KPTRLWVAPPTRMDWAILQEEGYYSIFGDAGARTEMPGCSL 387
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*
gi 85093919 455 CIGQWDRrdTPKGTpnSILSSYNRNFTGRNDGNpaTHSFVTSPDLVVAMSIAGSL 509
Cdd:cd01581 388 CMGNQAR--VADGA--TVFSTSTRNFDNRVGKG--AEVYLGSAELAAVCALLGRI 436
PRK09238 PRK09238
bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated
171-509 1.77e-11

bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated


Pssm-ID: 236424 [Multi-domain]  Cd Length: 835  Bit Score: 67.90  E-value: 1.77e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  171 KPGSGIIHQIiLENYAFPGGLLIGTDSHT--------PNAAGLgmaaigVGGADAVDVMAnlpweLKAPKVIGVKLTGAL 242
Cdd:PRK09238 462 RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfpigisfPAGSGL------VAFAAATGVMP-----LDMPESVLVRFKGEM 529
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  243 NGWTTPKDVI-------LKlAGILTV--KGG----TGSIVEYygEGASSMSATGKATCGNMGAEIGATTSVFPYDKA-MF 308
Cdd:PRK09238 530 QPGITLRDLVhaipyyaIK-QGLLTVekKGKknifSGRILEI--EGLPDLKVEQAFELTDASAERSAAGCTIKLSKEpII 606
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  309 DYLvatkRSDIA----------EFAKTYQKE-------------LQADEGAEYDQHIEINLNEL-EPHINGPFTPDLATP 364
Cdd:PRK09238 607 EYL----RSNIVllkwmiaegyGDARTLERRiaameewlanpelLEADADAEYAAVIEIDLAEIkEPILACPNDPDDVRL 682
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  365 ISKFAQaakennwpEELKVGLIGSC-TNssYEDMTRAASIARdalDHGLKAKAAFVVTPGSEQIRATIARDGQLQTFEEF 443
Cdd:PRK09238 683 LSEVAG--------TKIDEVFIGSCmTN--IGHFRAAGKLLE---GKKGQLPTRLWVAPPTKMDADQLTEEGYYSIFGKA 749
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 85093919  444 GGTVLANACGPCIGQWDRrdTPKGTpnSILSSYNRNFTGR--NDGNpathSFVTSPDLVVAMSIAGSL 509
Cdd:PRK09238 750 GARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKGAN----VYLGSAELAAVCALLGRI 809
IPMI_Swivel cd01577
Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized ...
662-730 2.80e-11

Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238809 [Multi-domain]  Cd Length: 91  Bit Score: 60.29  E-value: 2.80e-11
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919 662 VVIGDwNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYD-KISPEDKVDI 730
Cdd:cd01577  21 IVAGK-NFGCGSSREHAPWALKDAGIRAVIAESFARIFFRNAINNGLLPVTLADEDVEEvEAKPGDEVEV 89
LeuD COG0066
3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];
662-730 2.14e-09

3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];


Pssm-ID: 223144 [Multi-domain]  Cd Length: 191  Bit Score: 57.60  E-value: 2.14e-09
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 85093919 662 VVIGDwNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPA--DYDKISPEDKVDI 730
Cdd:COG0066  66 LVAGE-NFGCGSSREHAPWALKDYGIRAVIAPSFADIFYRNAINNGLLPIVLAEEDvtELFEDVPGDEVTV 135
leuD PRK00439
3-isopropylmalate dehydratase small subunit; Reviewed
662-730 2.29e-08

3-isopropylmalate dehydratase small subunit; Reviewed


Pssm-ID: 234762 [Multi-domain]  Cd Length: 163  Bit Score: 54.06  E-value: 2.29e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 85093919  662 VVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGmLPLtFADPADYDKISPEDKVDI 730
Cdd:PRK00439  51 IIVAGKNFGCGSSREHAPIALKAAGVSAVIAKSFARIFYRNAINIG-LPV-LECDEAVDKIEDGDEVEV 117
PLN00094 PLN00094
aconitate hydratase 2; Provisional
171-509 2.90e-08

aconitate hydratase 2; Provisional


Pssm-ID: 215053 [Multi-domain]  Cd Length: 938  Bit Score: 57.24  E-value: 2.90e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  171 KPGSGIIHQIiLENYAFPGGLLIGTDSHT------PNAAGLGMAAIGVggadAVDVMAnlpweLKAPKVIGVKLTGALNG 244
Cdd:PLN00094 536 RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfpigiSFPAGSGLVAFGA----ATGVIP-----LDMPESVLVRFTGTMQP 605
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  245 WTTPKDVILKL------AGILTV-KGG-----TGSIVEYygEGASSMSATGKATCGNMGAEIGATTSVFPYDKA------ 306
Cdd:PLN00094 606 GITLRDLVHAIpytaiqDGLLTVeKKGkknvfSGRILEI--EGLPHLKCEQAFELSDASAERSAAGCTIKLDKEpiieyl 683
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  307 -----MFDYLVATKRSDiaefAKTYQKE-------------LQADEGAEYDQHIEINLNEL-EPHINGPFTPDLATPISK 367
Cdd:PLN00094 684 nsnvvMLKWMIAEGYGD----RRTLERRiarmqqwladpelLEADPDAEYAAVIEIDMDEIkEPILCAPNDPDDARLLSE 759
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919  368 FAQaakennwpEELKVGLIGSC-TNSSYedmTRAAsiARDALDHGLKAKAAFVVTPGSEQIRATIARDGQLQTFEEFGGT 446
Cdd:PLN00094 760 VTG--------DKIDEVFIGSCmTNIGH---FRAA--GKLLNDNLSQLPTRLWVAPPTKMDEAQLKAEGYYSTFGTVGAR 826
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 85093919  447 VLANACGPCIGQwDRRDTPKGTpnsILSSYNRNFTGRNdgNPATHSFVTSPDLVVAMSIAGSL 509
Cdd:PLN00094 827 TEMPGCSLCMGN-QARVAEKST---VVSTSTRNFPNRL--GKGANVYLASAELAAVAAILGRL 883
LEUD_arch TIGR02087
3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the ...
662-750 1.29e-07

3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the 3-isopropylmalate dehydratase, small subunits which form TIGR00171. This subfamily includes the members of TIGR02084 which are gene clustered with other genes of leucine biosynthesis. The rest of the subfamily includes mainly archaeal species which exhibit two hits to this model. In these cases it is possible that one or the other of the hits does not have a 3-isopropylmalate dehydratase activity but rather one of the other related aconitase-like activities.


Pssm-ID: 273961 [Multi-domain]  Cd Length: 154  Bit Score: 51.65  E-value: 1.29e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85093919   662 VVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGmLPLTFAdPADYDKISPEDKVDILCTELAVGKPI 741
Cdd:TIGR02087  50 VIVAGKNFGCGSSREQAALALKAAGIAAVIAESFARIFYRNAINIG-LPLIEA-KTEGIKDGDEVTVDLETGEIRVNGNE 127

                  ....*....
gi 85093919   742 TMRVHPKNG 750
Cdd:TIGR02087 128 EYKGEPLPD 136
PRK14023 PRK14023
homoaconitate hydratase small subunit; Provisional
648-718 1.58e-07

homoaconitate hydratase small subunit; Provisional


Pssm-ID: 184460 [Multi-domain]  Cd Length: 166  Bit Score: 51.73  E-value: 1.58e-07
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 85093919  648 PAVARDYKAKNIpwvVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPAD 718
Cdd:PRK14023  41 PEFASTVRPGDI---LVAGRNFGLGSSREYAPEALKMLGIGAIIAKSYARIFYRNLVNLGIPPFESEEVVD 108
leuD PRK01641
3-isopropylmalate dehydratase small subunit;
668-722 4.48e-05

3-isopropylmalate dehydratase small subunit;


Pssm-ID: 179314 [Multi-domain]  Cd Length: 200  Bit Score: 45.12  E-value: 4.48e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 85093919  668 NYGEGSSREHA--ALEprHLGGLAIITRSFARIHETNLKKQGMLPLTfADPADYDKI 722
Cdd:PRK01641  76 NFGCGSSREHApwALA--DYGFRAVIAPSFADIFYNNCFKNGLLPIV-LPEEDVDEL 129
PLN00072 PLN00072
3-isopropylmalate isomerase/dehydratase small subunit; Provisional
662-698 2.57e-03

3-isopropylmalate isomerase/dehydratase small subunit; Provisional


Pssm-ID: 177701 [Multi-domain]  Cd Length: 246  Bit Score: 40.23  E-value: 2.57e-03
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 85093919  662 VVIGDWNYGEGSSREHAALEPRHLGGLAIITRSFARI 698
Cdd:PLN00072 132 IIIGGENFGCGSSREHAPVALGAAGAKAVVAESYARI 168
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH