NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|158297404|ref|XP_317642|]
View 

AGAP007852-PA, partial [Anopheles gambiae str. PEST]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
aconitase_mito super family cl36873
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
49-779 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


The actual alignment was detected with superfamily member TIGR01340:

Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1315.64  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404   49 YEKLQKNLEVVKKRLG-RPLTLSEKVLYSHLDDPAN----QDIE--RGVSYLRLRPDRVAMQDATAQMAMLQFISSGLKR 121
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  122 VAVPSTIHCDHLIEAQIGGEKDLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPN 201
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  202 GGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISC 281
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  282 TGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSAIAAEA--GKYQGSVLTADSGAKYDQVIEINLDTLEPHINGPFT 359
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAktGQYSFFKLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  360 PDLAHPISKLGANAKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKNAMKHGLKSKIPFNVTPGSEQIRATIERDGIAK 439
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  440 TFKEFGGTVLANACGPCIGQWDRKD-VKKGEKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGTLNFNPLTDE 518
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  519 LTGADGKKFKLDSPYGDELPQKGFDPGMDTYEAPP-SDGTSVKVDVDPKSQRLQLLEPFDVWNGKDLTEMTVLIKVKGKC 597
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPgSPNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  598 TTDHISAAGPWLKYRGHLDNISNNMFIGATNIENNEMNKIKNQvTGEWAGVPDVARFYKSKGINWVAVGDENYGEGSSRE 677
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  678 HAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKVQPTSKISILGLNNFAP---GKQLDCEI-KTDGKV 753
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVtKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 158297404  754 HKIKLNHSFNQQQIEWFKAGSALNRM 779
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
49-779 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1315.64  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404   49 YEKLQKNLEVVKKRLG-RPLTLSEKVLYSHLDDPAN----QDIE--RGVSYLRLRPDRVAMQDATAQMAMLQFISSGLKR 121
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  122 VAVPSTIHCDHLIEAQIGGEKDLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPN 201
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  202 GGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISC 281
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  282 TGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSAIAAEA--GKYQGSVLTADSGAKYDQVIEINLDTLEPHINGPFT 359
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAktGQYSFFKLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  360 PDLAHPISKLGANAKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKNAMKHGLKSKIPFNVTPGSEQIRATIERDGIAK 439
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  440 TFKEFGGTVLANACGPCIGQWDRKD-VKKGEKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGTLNFNPLTDE 518
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  519 LTGADGKKFKLDSPYGDELPQKGFDPGMDTYEAPP-SDGTSVKVDVDPKSQRLQLLEPFDVWNGKDLTEMTVLIKVKGKC 597
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPgSPNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  598 TTDHISAAGPWLKYRGHLDNISNNMFIGATNIENNEMNKIKNQvTGEWAGVPDVARFYKSKGINWVAVGDENYGEGSSRE 677
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  678 HAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKVQPTSKISILGLNNFAP---GKQLDCEI-KTDGKV 753
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVtKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 158297404  754 HKIKLNHSFNQQQIEWFKAGSALNRM 779
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
65-781 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 898.35  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  65 RPLTLSEKVLYSHLDDPanqDIERGVSyLRLRPDRVAMQDATAQMAMLQFISSGLKRVAVPSTI-HCDHlieaqiggekD 143
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 144 LARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMAN 223
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 224 IPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPF 303
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 304 NKRMADYLASTGRSAIAAEagkyqgsvLTADSGAKYDQVIEINLDTLEPHINGPFTPDLAHPISKLGanakkngyPMDIR 383
Cdd:PRK07229 227 DERTREFLKAQGREDDWVE--------LLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVA--------GIKVD 290
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 384 VGLIGSCTNSSYEDMGRCASIAKNamkHGLKSKIPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQwdrk 463
Cdd:PRK07229 291 QVLIGSCTNSSYEDLMRAASILKG---KKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM---- 363
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 464 DVKKGEKNTIVTSYNRNFTGRNdANPATHCFVTSPELVTALSIAGTLNfNPLTDELTGadGKKFKLDSPygdelpqKGFD 543
Cdd:PRK07229 364 GQAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRTLALEN--GEYPKLEEP-------EGFA 432
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 544 PGMDTYEAPPSDGTSVKVDVDPKSQRLQLLEPFDvwngkDLTEMTVLIKVKGKCTTDHISAAGP-WLKYRGHLDNISNNM 622
Cdd:PRK07229 433 VDDAGIIAPAEDGSDVEVVRGPNIKPLPLLEPLP-----DLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFV 507
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 623 FIGATNiENNEmnKIKNQvtgewagvpdvarfykskgINWVAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHET 702
Cdd:PRK07229 508 FEGVDN-TFPE--RAKEQ-------------------GGGIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKA 565
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 158297404 703 NLKKQGLLPLTFANPADYDKVQPTSKISILGLNNFAPGKQLDCEIKTDGKvhKIKLNHSFNQQQIEWFKAGSALNRMKQ 781
Cdd:PRK07229 566 NLINFGILPLTFADPADYDKIEEGDVLEIEDLREFLPGGPLTVVNVTKDE--EIEVRHTLSERQIEILLAGGALNLIKK 642
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
99-510 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134  Cd Length: 412  Bit Score: 826.69  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  99 RVAMQDATAQMAMLQFISSGLKRVAVPSTIHCDHLIEAQIGGEKDLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIH 178
Cdd:cd01584    1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 179 QIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADI 258
Cdd:cd01584   81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 259 LTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSAIAAEAGKYQGSVLTADSGAK 338
Cdd:cd01584  161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKDDLLVADEGAE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 339 YDQVIEINLDTLEPHINGPFTPDLAHPISKLGANAKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKNAMKHGLKSKIP 418
Cdd:cd01584  241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 419 FNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDRKDVKKGEKNTIVTSYNRNFTGRNDANPATHCFVTSP 498
Cdd:cd01584  321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                        410
                 ....*....|..
gi 158297404 499 ELVTALSIAGTL 510
Cdd:cd01584  401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
57-781 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 699.85  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  57 EVVKKRLGRPLTLSEKVLYSHLDDPAN------QDIERGV------SYLRLRPDRVAMQDATAQMAmlQFISSGLKRVA- 123
Cdd:COG1048   23 KLEESGKISKLPYSLKILLENLLRGEDgteehiEALARWLpsgkpeKEIAFRPARVVMQDFTGVPA--VVDLAAMRDAMv 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 124 ------------VPSTIHCDHLIEAQIGG-----EKDLARAKDINSEVYKFL-STAGAKYGVGFWKPGSGIIHQIILENY 185
Cdd:COG1048  101 elggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLkWAAKAFYNFRVVPPGTGIIHQVNLEYL 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 186 AF-----PGLL----MIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVA 256
Cdd:COG1048  181 AKvvwakPGVAypdtLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPEVVGVKLTGKLPEGVTATDLVLTVT 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 257 DILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRS----AIAAEAGKYQG-SVL 331
Cdd:COG1048  261 GMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLRLTGRSeeqvALVEAYAKAQGlWYD 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 332 TADSGAKYDQVIEINLDTLEPHINGPFTPDLAHPISKLGANAKKNGY----------------PMDIRVGLIGSCTNSSY 395
Cdd:COG1048  341 PADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAENFEKILReieikrvysllgkelgDGKVVIAAITSCTNTSN 420
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 396 EDMGRCASI-AKNAMKHGLKSK--IPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDRKD---VKKGE 469
Cdd:COG1048  421 PDVLIAAGLlAKKAVEKGLKVKpwVKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNIVGYGCTTCIGNSGPLPeeiEKAIN 500
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 470 KNTIVT----SYNRNFTGRNdANPATHCFVTSPELVTALSIAGTLNFNPLTDEL-TGADGKK---FKLDSPYGDELPQKG 541
Cdd:COG1048  501 DNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLgTDNDGKPvylKDIWPSTEEIAEAVG 579
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 542 FDPGMDTYEAPPSDG--------TSVKVDVDPKSQRLQLLEPFDVWNGKD---LTEMTVLIKVKGKCTTDHISAAG---- 606
Cdd:COG1048  580 KAVKPEMFRKEYADVfkwnaievPEGPLYDWPNISTYIRLPPFFDGMGAEpkpIKGARVLAKLGDSITTDHISPAGsika 659
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 607 ----PWLKYRGHLDNISNNMFIGATNIENNEMN------KIKNQVTGEWAG---------VPDVARFYKSKGINWVAVGD 667
Cdd:COG1048  660 dspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRgtfaniRIRNEMVPGEGGytihqpsgeIYDAAMKYKEEGIPLVVVAG 739
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 668 ENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKV--QPTSKISILGLNNFAPGKQLDC 745
Cdd:COG1048  740 KNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGETYDKLglDGEETIDIGGLENLKPGATVTV 819
                        810       820       830
                 ....*....|....*....|....*....|....*...
gi 158297404 746 EIKT-DGKVHKI-KLNHSFNQQQIEWFKAGSALNRMKQ 781
Cdd:COG1048  820 TVTRgDGPVEEFpVLCRIDTAEEIEYYKAGGILNYVKR 857
Aconitase pfam00330
Aconitase family (aconitate hydratase);
71-508 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 395261  Cd Length: 458  Bit Score: 538.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404   71 EKVLYSHLDDPANQDIergvSYLrlrPDRVAMQDATAQMAMLQFISSGLKR-----------VAVPSTIHCDHlieaqiG 139
Cdd:pfam00330   1 EKIWDAHLVEELDGSL----LYI---PDRVLLHDVTSPQAFVDLRAAGRAVrrpggtpatidHLVPTDLVIDR------D 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  140 GEKDLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILEN-YAFPGLLMIGTDSHTPNggglgglcigvggA--- 215
Cdd:pfam00330  68 LDKNIEDEISRNKEQYDFLEWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTT-------------Hggl 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  216 ----------DAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMA 285
Cdd:pfam00330 135 galafgvggsEAEHVLATQPLEMKKPKVVGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGVRSLSMEGRA 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  286 TICNMGAEIGATTSIFPFNKRMADYLASTGRS--AIAAEAGKYQG-SVLTADSGAKYDQVIEINLDTLEPHINGPFTPDL 362
Cdd:pfam00330 215 TICNMAIEYGATAGLFPPDETTFEYLRATGRPeaPKGEAYDKAVAlWRLASDPGAVYDKVVEIDLSTIEPMVTGPTSPQD 294
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  363 AHPISKLGANA-------------------KKNGYPM---DIRVGLIGSCTNSSYEDMGRCASIAKNAMKHGLKSK--IP 418
Cdd:pfam00330 295 AVPLSELVPDPafaddvereaaeraleymgLEPGTPLedgKVDIAFIGSCTNSSIEDLRAAAGLLKKAVEKGLKVApgVK 374
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  419 FNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDRkdVKKGEknTIVTSYNRNFTGRNdaNPATHCFVTSP 498
Cdd:pfam00330 375 ASVVPGSEVVRAYAEAEGLDKILEEAGFEWRGPGCSMCIGNSDR--LPPGE--RCVSSSNRNFEGRQ--GPGGRTHLASP 448
                         490
                  ....*....|
gi 158297404  499 ELVTALSIAG 508
Cdd:pfam00330 449 ALVAAAAIAG 458
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
49-779 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1315.64  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404   49 YEKLQKNLEVVKKRLG-RPLTLSEKVLYSHLDDPAN----QDIE--RGVSYLRLRPDRVAMQDATAQMAMLQFISSGLKR 121
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIGdvRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  122 VAVPSTIHCDHLIEAQIGGEKDLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPN 201
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  202 GGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISC 281
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  282 TGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSAIAAEA--GKYQGSVLTADSGAKYDQVIEINLDTLEPHINGPFT 359
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAktGQYSFFKLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  360 PDLAHPISKLGANAKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKNAMKHGLKSKIPFNVTPGSEQIRATIERDGIAK 439
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  440 TFKEFGGTVLANACGPCIGQWDRKD-VKKGEKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGTLNFNPLTDE 518
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  519 LTGADGKKFKLDSPYGDELPQKGFDPGMDTYEAPP-SDGTSVKVDVDPKSQRLQLLEPFDVWNGKDLTEMTVLIKVKGKC 597
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPgSPNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  598 TTDHISAAGPWLKYRGHLDNISNNMFIGATNIENNEMNKIKNQvTGEWAGVPDVARFYKSKGINWVAVGDENYGEGSSRE 677
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  678 HAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKVQPTSKISILGLNNFAP---GKQLDCEI-KTDGKV 753
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVtKKNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 158297404  754 HKIKLNHSFNQQQIEWFKAGSALNRM 779
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
65-781 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 898.35  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  65 RPLTLSEKVLYSHLDDPanqDIERGVSyLRLRPDRVAMQDATAQMAMLQFISSGLKRVAVPSTI-HCDHlieaqiggekD 143
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 144 LARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMAN 223
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 224 IPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPF 303
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 304 NKRMADYLASTGRSAIAAEagkyqgsvLTADSGAKYDQVIEINLDTLEPHINGPFTPDLAHPISKLGanakkngyPMDIR 383
Cdd:PRK07229 227 DERTREFLKAQGREDDWVE--------LLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVA--------GIKVD 290
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 384 VGLIGSCTNSSYEDMGRCASIAKNamkHGLKSKIPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQwdrk 463
Cdd:PRK07229 291 QVLIGSCTNSSYEDLMRAASILKG---KKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM---- 363
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 464 DVKKGEKNTIVTSYNRNFTGRNdANPATHCFVTSPELVTALSIAGTLNfNPLTDELTGadGKKFKLDSPygdelpqKGFD 543
Cdd:PRK07229 364 GQAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRTLALEN--GEYPKLEEP-------EGFA 432
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 544 PGMDTYEAPPSDGTSVKVDVDPKSQRLQLLEPFDvwngkDLTEMTVLIKVKGKCTTDHISAAGP-WLKYRGHLDNISNNM 622
Cdd:PRK07229 433 VDDAGIIAPAEDGSDVEVVRGPNIKPLPLLEPLP-----DLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFV 507
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 623 FIGATNiENNEmnKIKNQvtgewagvpdvarfykskgINWVAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHET 702
Cdd:PRK07229 508 FEGVDN-TFPE--RAKEQ-------------------GGGIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKA 565
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 158297404 703 NLKKQGLLPLTFANPADYDKVQPTSKISILGLNNFAPGKQLDCEIKTDGKvhKIKLNHSFNQQQIEWFKAGSALNRMKQ 781
Cdd:PRK07229 566 NLINFGILPLTFADPADYDKIEEGDVLEIEDLREFLPGGPLTVVNVTKDE--EIEVRHTLSERQIEILLAGGALNLIKK 642
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
99-510 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134  Cd Length: 412  Bit Score: 826.69  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  99 RVAMQDATAQMAMLQFISSGLKRVAVPSTIHCDHLIEAQIGGEKDLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIH 178
Cdd:cd01584    1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 179 QIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADI 258
Cdd:cd01584   81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 259 LTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSAIAAEAGKYQGSVLTADSGAK 338
Cdd:cd01584  161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKDDLLVADEGAE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 339 YDQVIEINLDTLEPHINGPFTPDLAHPISKLGANAKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKNAMKHGLKSKIP 418
Cdd:cd01584  241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 419 FNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDRKDVKKGEKNTIVTSYNRNFTGRNDANPATHCFVTSP 498
Cdd:cd01584  321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                        410
                 ....*....|..
gi 158297404 499 ELVTALSIAGTL 510
Cdd:cd01584  401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
57-781 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 699.85  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  57 EVVKKRLGRPLTLSEKVLYSHLDDPAN------QDIERGV------SYLRLRPDRVAMQDATAQMAmlQFISSGLKRVA- 123
Cdd:COG1048   23 KLEESGKISKLPYSLKILLENLLRGEDgteehiEALARWLpsgkpeKEIAFRPARVVMQDFTGVPA--VVDLAAMRDAMv 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 124 ------------VPSTIHCDHLIEAQIGG-----EKDLARAKDINSEVYKFL-STAGAKYGVGFWKPGSGIIHQIILENY 185
Cdd:COG1048  101 elggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLkWAAKAFYNFRVVPPGTGIIHQVNLEYL 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 186 AF-----PGLL----MIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVA 256
Cdd:COG1048  181 AKvvwakPGVAypdtLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPEVVGVKLTGKLPEGVTATDLVLTVT 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 257 DILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRS----AIAAEAGKYQG-SVL 331
Cdd:COG1048  261 GMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLRLTGRSeeqvALVEAYAKAQGlWYD 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 332 TADSGAKYDQVIEINLDTLEPHINGPFTPDLAHPISKLGANAKKNGY----------------PMDIRVGLIGSCTNSSY 395
Cdd:COG1048  341 PADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAENFEKILReieikrvysllgkelgDGKVVIAAITSCTNTSN 420
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 396 EDMGRCASI-AKNAMKHGLKSK--IPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDRKD---VKKGE 469
Cdd:COG1048  421 PDVLIAAGLlAKKAVEKGLKVKpwVKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNIVGYGCTTCIGNSGPLPeeiEKAIN 500
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 470 KNTIVT----SYNRNFTGRNdANPATHCFVTSPELVTALSIAGTLNFNPLTDEL-TGADGKK---FKLDSPYGDELPQKG 541
Cdd:COG1048  501 DNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLgTDNDGKPvylKDIWPSTEEIAEAVG 579
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 542 FDPGMDTYEAPPSDG--------TSVKVDVDPKSQRLQLLEPFDVWNGKD---LTEMTVLIKVKGKCTTDHISAAG---- 606
Cdd:COG1048  580 KAVKPEMFRKEYADVfkwnaievPEGPLYDWPNISTYIRLPPFFDGMGAEpkpIKGARVLAKLGDSITTDHISPAGsika 659
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 607 ----PWLKYRGHLDNISNNMFIGATNIENNEMN------KIKNQVTGEWAG---------VPDVARFYKSKGINWVAVGD 667
Cdd:COG1048  660 dspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRgtfaniRIRNEMVPGEGGytihqpsgeIYDAAMKYKEEGIPLVVVAG 739
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 668 ENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKV--QPTSKISILGLNNFAPGKQLDC 745
Cdd:COG1048  740 KNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGETYDKLglDGEETIDIGGLENLKPGATVTV 819
                        810       820       830
                 ....*....|....*....|....*....|....*...
gi 158297404 746 EIKT-DGKVHKI-KLNHSFNQQQIEWFKAGSALNRMKQ 781
Cdd:COG1048  820 TVTRgDGPVEEFpVLCRIDTAEEIEYYKAGGILNYVKR 857
Aconitase pfam00330
Aconitase family (aconitate hydratase);
71-508 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 395261  Cd Length: 458  Bit Score: 538.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404   71 EKVLYSHLDDPANQDIergvSYLrlrPDRVAMQDATAQMAMLQFISSGLKR-----------VAVPSTIHCDHlieaqiG 139
Cdd:pfam00330   1 EKIWDAHLVEELDGSL----LYI---PDRVLLHDVTSPQAFVDLRAAGRAVrrpggtpatidHLVPTDLVIDR------D 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  140 GEKDLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILEN-YAFPGLLMIGTDSHTPNggglgglcigvggA--- 215
Cdd:pfam00330  68 LDKNIEDEISRNKEQYDFLEWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTT-------------Hggl 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  216 ----------DAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMA 285
Cdd:pfam00330 135 galafgvggsEAEHVLATQPLEMKKPKVVGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGVRSLSMEGRA 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  286 TICNMGAEIGATTSIFPFNKRMADYLASTGRS--AIAAEAGKYQG-SVLTADSGAKYDQVIEINLDTLEPHINGPFTPDL 362
Cdd:pfam00330 215 TICNMAIEYGATAGLFPPDETTFEYLRATGRPeaPKGEAYDKAVAlWRLASDPGAVYDKVVEIDLSTIEPMVTGPTSPQD 294
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  363 AHPISKLGANA-------------------KKNGYPM---DIRVGLIGSCTNSSYEDMGRCASIAKNAMKHGLKSK--IP 418
Cdd:pfam00330 295 AVPLSELVPDPafaddvereaaeraleymgLEPGTPLedgKVDIAFIGSCTNSSIEDLRAAAGLLKKAVEKGLKVApgVK 374
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  419 FNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDRkdVKKGEknTIVTSYNRNFTGRNdaNPATHCFVTSP 498
Cdd:pfam00330 375 ASVVPGSEVVRAYAEAEGLDKILEEAGFEWRGPGCSMCIGNSDR--LPPGE--RCVSSSNRNFEGRQ--GPGGRTHLASP 448
                         490
                  ....*....|
gi 158297404  499 ELVTALSIAG 508
Cdd:pfam00330 449 ALVAAAAIAG 458
Aconitase cd01351
Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and ...
99-510 5.86e-142

Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Aconitase catalytic domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. Aconitase, in its active form, contains a 4Fe-4S iron-sulfur cluster; three cysteine residues have been shown to be ligands of the 4Fe-4S cluster. This is the Aconitase core domain, including structural domains 1, 2 and 3, which binds the Fe-S cluster. The aconitase family also contains the following proteins: - Iron-responsive element binding protein (IRE-BP), a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 153129  Cd Length: 389  Bit Score: 423.06  E-value: 5.86e-142
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  99 RVAMQDATAQMAMLQFISSGLK-RVAVPSTIHCDHLIEAQIggekdlarAKDINSEVYKFLSTAGAKYGVGFWKPGSGII 177
Cdd:cd01351    1 RVMLQDATGPMAMKAFEILAALgKVADPSQIACVHDHAVQL--------EKPVNNEGHKFLSFFAALQGIAFYRPGVGII 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 178 HQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVAD 257
Cdd:cd01351   73 HQIMVENLALPGDLLVGSDSHTTSYGGLGAISTGAGGGDVAFVMAGGPAWLKKPEVVGVNLTGKLSPGVTGKDVVLKLGG 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 258 ILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSAIAAEAGKYQGSvLTADSGA 337
Cdd:cd01351  153 IVGVDGVLNRIVEFYGEGVSSLSIEDRLTICNMMAELGATTGIFPEDKTTLKWLEATGRPLLKNLWLAFPEE-LLADEGA 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 338 KYDQVIEINLDTLEPHINGPFTPDLAHPISKLGAnakkngypMDIRVGLIGSCTNSSYEDMGRCASIAKnamKHGLKSKI 417
Cdd:cd01351  232 EYDQVIEIDLSELEPDISGPNRPDDAVSVSEVEG--------TKIDQVLIGSCTNNRYSDMLAAAKLLK---GAKVAPGV 300
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 418 PFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDRkdvKKGEKNTIVTSYNRNFTGRNDANPAtHCFVTS 497
Cdd:cd01351  301 RLIVTPGSRMVYATLSREGYYEILVDSGARILPPGCGPCMGNGAR---LVADGEVGVSSGNRNFPGRLGTYER-HVYLAS 376
                        410
                 ....*....|...
gi 158297404 498 PELVTALSIAGTL 510
Cdd:cd01351  377 PELAAATAIAGKI 389
acon_putative TIGR01342
aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins ...
68-781 3.89e-119

aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins homologous (and likely functionally equivalent to) aconitase 1. Members are found, so far in the anaerobe Clostridium acetobutylicum, in the microaerophilic, early-branching bacterium Aquifex aeolicus, and in the halophilic archaeon Halobacterium sp. NRC-1. No member is experimentally characterized. [Energy metabolism, TCA cycle]


Pssm-ID: 130409 [Multi-domain]  Cd Length: 658  Bit Score: 373.55  E-value: 3.89e-119
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404   68 TLSEKVLYSHLddpANQDIERGvSYLRLRPDRVAMQDATAQMAMLQFISSGLKRVAVP-STIHCDHLIEaqiggEKDLAR 146
Cdd:TIGR01342   1 TLAEKIIDDHL---VEGDLEPG-EEIAIEIDQTLSQDATGTMCWLEFEALEMDEVKTElAAQYCDHNML-----QFDFKN 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  147 AKDinsevYKFLSTAGAKYGVGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPW 226
Cdd:TIGR01342  72 ADD-----HKFLMSAAGKFGAWFSKPGNGICHNVHKENFAAPGKTLLGSDSHTPTAGGLGMLAIGAGGIDIAAAMAGEAF 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  227 ELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKR 306
Cdd:TIGR01342 147 YLEMPEIVGVHLEGELPEWATAKDIILELLRRLSVKGGLGKIFEYFGEGVEELSVPERATITNMGAELGATSSIFPSDDI 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  307 MADYLASTGRSAIAAEagkyqgsvLTADSGAKYDQVIEINLDTLEPHINGPFTPDLAHPISKLGAnakkngypMDIRVGL 386
Cdd:TIGR01342 227 TEAWLAAFDREDDFVD--------LLADADAEYADEIEIDLSDLEPLIAEPHMPDNVVPVREIAG--------IEVDQVM 290
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  387 IGSCTNSSYEDMGRCASIAKNAMKHglkSKIPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQwdrkDVK 466
Cdd:TIGR01342 291 IGSCTNGAFEDLLPAAKLLEGREVH---KDTEFAVAPGSKQALELIAQEGALAEFLAAGANFLEAACGACIGI----GFA 363
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  467 KGEKNTIVTSYNRNFTGRNdANPATHCFVTSPELVTALSIAGTLnFNP--LTDELTGADGKKFKLDSPYgdelpQKGFDP 544
Cdd:TIGR01342 364 PASDGVSLRSFNRNFEGRA-GIEDAKVYLASPETATAAAIAGEI-IDPrdLADDEGDLEAIGFEMGEKF-----PGGYDA 436
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  545 GmDTYEAPPSDGTSVKVDVDPKSQRLQLLEPFdvwnGKDLtEMTVLIKVKGKCTTDHISAAGP-WLKYRGHLDNISNNMF 623
Cdd:TIGR01342 437 A-DIDIIPKEEREDDDIIKGPNIKPLPEFDPL----GADI-EGETALIMEDNITTDHIIPAGAdILKFRSNIEAISEFTL 510
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  624 igatniennemnkikNQVTGEWAgvpDVARFYKSKGINWVAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETN 703
Cdd:TIGR01342 511 ---------------HRIDDEFA---ERAKAADEKGKAGIIIAGENYGQGSSREHAALAPMFLGVEAVIAKSFARIHHAN 572
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  704 LKKQGLLPLTFANPADYDKVQPTSKISILG--LNNFAPGKQLDCEIKTDGKVHKIKLNHSFNQQQIewFKAGSALNRMKQ 781
Cdd:TIGR01342 573 LFNFGILPLEFDNEEDYAKFELGDDIEIPDdlAAALADGEDEFTINKNDDEEALATLDASEREKEI--LAAGGKLNLIKN 650
AcnA_Mitochon_Swivel cd01578
Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and ...
592-740 1.44e-102

Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 238810 [Multi-domain]  Cd Length: 149  Bit Score: 312.10  E-value: 1.44e-102
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 592 KVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNIENNEMNKIKNQVTGEWAGVPDVARFYKSKGINWVAVGDENYG 671
Cdd:cd01578    1 KAKGKCTTDHISAAGPWLKYRGHLDNISNNLLIGAINAENGKANSVKNQVTGEYGPVPDTARDYKAHGIKWVVIGDENYG 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 158297404 672 EGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKVQPTSKISILGLNNFAPG 740
Cdd:cd01578   81 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYDKIHPDDKVDILGLTDFAPG 149
AcnA_Bact cd01585
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
98-510 1.11e-101

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Bacterial Aconitase-like catalytic domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This distinct subfamily is found only in bacteria and Archaea. Its exact characteristics are not known.


Pssm-ID: 153135  Cd Length: 380  Bit Score: 318.62  E-value: 1.11e-101
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  98 DRVAMQDATAQMAMLQFISSGLKRVAVP-STIHCDHLIeAQIGGEkdlarakdiNSEVYKFLSTAGAKYGVGFWKPGSGI 176
Cdd:cd01585    1 DQTLTQDATGTMAYLQFEAMGVDRVRTElSVSYVDHNT-LQTDFE---------NADDHRFLQTVAARYGIYFSRPGNGI 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 177 IHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVA 256
Cdd:cd01585   71 CHQVHLERFAVPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYYIPMPKVVGVRLTGELPPWVTAKDVILELL 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 257 DILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSAIAAEagkyqgsvLTADSG 336
Cdd:cd01585  151 RRLTVKGGVGKIFEYTGPGVATLSVPERATITNMGAELGATTSIFPSDERTREFLAAQGREDDWVE--------LAADAD 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 337 AKYDQVIEINLDTLEPHINGPFTPDLAHPISKLGanakknGYPMDiRVgLIGSCTNSSYEDMGRCASIAKNAMKHglkSK 416
Cdd:cd01585  223 AEYDEEIEIDLSELEPLIARPHSPDNVVPVREVA------GIKVD-QV-AIGSCTNSSYEDLMTVAAILKGRRVH---PH 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 417 IPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDrkdvKKGEKNTIVTSYNRNFTGRNdANPATHCFVT 496
Cdd:cd01585  292 VSMVVAPGSKQVLEMLARNGALADLLAAGARILESACGPCIGMGQ----APPTGGVSVRTFNRNFEGRS-GTKDDLVYLA 366
                        410
                 ....*....|....
gi 158297404 497 SPELVTALSIAGTL 510
Cdd:cd01585  367 SPEVAAAAALTGVI 380
PRK09277 PRK09277
aconitate hydratase AcnA;
96-758 2.02e-73

aconitate hydratase AcnA;


Pssm-ID: 236445 [Multi-domain]  Cd Length: 888  Bit Score: 256.59  E-value: 2.02e-73
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  96 RPDRVAMQDATAQ------MAMlqfissglkRVAV------PSTIH--------CDHLIEAQIGGEKD-LARAKDI---- 150
Cdd:PRK09277  83 RPARVVMQDFTGVpavvdlAAM---------RDAIadlggdPAKINplvpvdlvIDHSVQVDYFGTPDaFEKNVELefer 153
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 151 NSEVYKFL---STAGAKYGVgfWKPGSGIIHQIILE-------------NYAFPGLLmIGTDSHTPnggglgglcigvgg 214
Cdd:PRK09277 154 NEERYQFLkwgQKAFDNFRV--VPPGTGICHQVNLEylapvvwtredgeLVAYPDTL-VGTDSHTT-------------- 216
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 215 adavdvMAN----IPW-------E---------LKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGN 274
Cdd:PRK09277 217 ------MINglgvLGWgvggieaEaamlgqpssMLIPEVVGVKLTGKLPEGVTATDLVLTVTEMLRKKGVVGKFVEFFGE 290
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 275 GVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSA--IAA-EA-GKYQGSVLTADSGAKYDQVIEINLDTL 350
Cdd:PRK09277 291 GLASLSLADRATIANMAPEYGATCGFFPIDEETLDYLRLTGRDEeqVALvEAyAKAQGLWRDPLEEPVYTDVLELDLSTV 370
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 351 EPHINGP-------FTPDLAHPISKL--------GANAKKNGYPMDIRVG-----LIGSCTNSS--YEDMGrCASIAKNA 408
Cdd:PRK09277 371 EPSLAGPkrpqdriPLSDVKEAFAKSaelgvqgfGLDEAEEGEDYELPDGavviaAITSCTNTSnpSVMIA-AGLLAKKA 449
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 409 MKHGLKSKiPFNVT---PGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIG---------QwdrKDVKkgEKNTIVT- 475
Cdd:PRK09277 450 VEKGLKVK-PWVKTslaPGSKVVTDYLEKAGLLPYLEALGFNLVGYGCTTCIGnsgplppeiE---KAIN--DNDLVVTa 523
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 476 --SYNRNFTGR----NDANpathcFVTSPELVTALSIAGTLNFNPLTDEL-TGADGKKFKLDS--PYGDE---LPQKGFD 543
Cdd:PRK09277 524 vlSGNRNFEGRihplVKAN-----YLASPPLVVAYALAGTVDIDLEKDPLgTDKDGNPVYLKDiwPSDEEidaVVAKAVK 598
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 544 PGM--DTYeAPPSDGTSV--KVDV--------DPKSQRLQ--------LLEPFDVwngKDLTEMTVLIKVKGKCTTDHIS 603
Cdd:PRK09277 599 PEMfrKEY-ADVFEGDERwnAIEVpegplydwDPDSTYIRnppyfegmLAEPGPV---RDIKGARVLALLGDSITTDHIS 674
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 604 ---------AAGPWLKYRG---------------HLdnisnNMfIGAT--NIennemnKIKNQV-------------TGE 644
Cdd:PRK09277 675 pagaikadsPAGKYLLEHGvepkdfnsygsrrgnHE-----VM-MRGTfaNI------RIRNEMvpgveggytrhfpEGE 742
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 645 WAGVPDVARFYKSKGINWVAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYD--K 722
Cdd:PRK09277 743 VMSIYDAAMKYKEEGTPLVVIAGKEYGTGSSRDWAAKGTRLLGVKAVIAESFERIHRSNLVGMGVLPLQFKPGESRKtlG 822
                        810       820       830
                 ....*....|....*....|....*....|....*..
gi 158297404 723 VQPTSKISILGLNNFAPGKQLDCEI-KTDGKVHKIKL 758
Cdd:PRK09277 823 LDGTETFDIEGLEDLKPGATVTVVItRADGEVVEFPV 859
acnA PRK12881
aconitate hydratase AcnA;
71-781 2.14e-72

aconitate hydratase AcnA;


Pssm-ID: 237246 [Multi-domain]  Cd Length: 889  Bit Score: 254.09  E-value: 2.14e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  71 EKVLYSHLDDPANQDIER-GVSYLRLRPDRVAMQDATAQMAMLQFisSGLKRVA-------------VPSTIHCDHLIEA 136
Cdd:PRK12881  56 KKVTEEHLEALANWLPERkSDDEIPFVPARVVMQDFTGVPALVDL--AAMRDAAaeaggdpakinplVPVDLVVDHSVAV 133
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 137 QIGGEKD-LARAKDI----NSEVYKFLS-TAGAKYGVGFWKPGSGIIHQIILE--------------NYAFPGLLmIGTD 196
Cdd:PRK12881 134 DYFGQKDaLDLNMKIefqrNAERYQFLKwGMQAFDNFRVVPPGTGIMHQVNLEylarvvhtkeddgdTVAYPDTL-VGTD 212
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 197 SHTP--NGGGLGGLCIGVGGADAVdvMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGN 274
Cdd:PRK12881 213 SHTTmiNGIGVLGWGVGGIEAEAV--MLGQPVYMLIPDVVGVELTGKLREGVTATDLVLTVTEMLRKEGVVGKFVEFFGE 290
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 275 GVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRS--AIAA-EA-GKYQGSVLTADSGAKYDQVIEINLDTL 350
Cdd:PRK12881 291 GVASLTLGDRATIANMAPEYGATMGFFPVDEQTLDYLRLTGRTeaQIALvEAyAKAQGLWGDPKAEPRYTRTLELDLSTV 370
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 351 EPHINGP---------------FTPDLAHPISKLGANAK---KNGYPM---DIRVGLIGSCTNSSyeD---MGRCASIAK 406
Cdd:PRK12881 371 APSLAGPkrpqdrialgnvksaFSDLFSKPVAENGFAKKaqtSNGVDLpdgAVAIAAITSCTNTS--NpsvLIAAGLLAK 448
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 407 NAMKHGLKSK--IPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCI---GQWDRKDVKKGEKNTI----VTSY 477
Cdd:PRK12881 449 KAVERGLTVKpwVKTSLAPGSKVVTEYLERAGLLPYLEKLGFGIVGYGCTTCIgnsGPLTPEIEQAITKNDLvaaaVLSG 528
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 478 NRNFTGRNDANpATHCFVTSPELVTALSIAGTLNFNPLTDEL-TGADGKKFKL-----DSPYGDELPQKGFDPGM--DTY 549
Cdd:PRK12881 529 NRNFEGRIHPN-IKANFLASPPLVVAYALAGTVRRDLMTEPLgKGKDGRPVYLkdiwpSSAEIDALVAFAVDPEDfrKNY 607
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 550 -EAPPSDGTSVKVDV--------DPKSQRLQllEP--FDVWNG-----KDLTEMTVLIKVKGKCTTDHIS---------A 604
Cdd:PRK12881 608 aEVFKGSELWAAIEApdgplydwDPKSTYIR--RPpfFDFSMGpaasiATVKGARPLAVLGDSITTDHISpagaikadsP 685
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 605 AGPWLKYRGHLDNISNN----------MFIGA-TNIennemnKIKNQV-------------TGEWAGVPDVARFYKSKGI 660
Cdd:PRK12881 686 AGKYLKENGVPKADFNSygsrrgnhevMMRGTfANV------RIKNLMipgkeggltlhqpSGEVLSIYDAAMRYQAAGT 759
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 661 NWVAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFA---NPADYdKVQPTSKISILGL-NN 736
Cdd:PRK12881 760 PLVVIAGEEYGTGSSRDWAAKGTRLLGVKAVIAESFERIHRSNLVGMGVLPLQFKggdSRQSL-GLTGGETFDIEGLpGE 838
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|....*..
gi 158297404 737 FAPGKQLDCEIK-TDGKVHKIKLNHSFN-QQQIEWFKAGSALNRMKQ 781
Cdd:PRK12881 839 IKPRQDVTLVIHrADGSTERVPVLCRIDtPIEVDYYKAGGILPYVLR 885
PTZ00092 PTZ00092
aconitate hydratase-like protein; Provisional
97-777 5.99e-66

aconitate hydratase-like protein; Provisional


Pssm-ID: 240263 [Multi-domain]  Cd Length: 898  Bit Score: 236.06  E-value: 5.99e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  97 PDRVAMQDATAQMAMLQF--ISSGLKRV---------AVPSTIHCDHLIEAQIGGEKDlARAKDI------NSEVYKFLs 159
Cdd:PTZ00092  90 PARVLLQDFTGVPAVVDLaaMRDAMKRLggdpakinpLVPVDLVIDHSVQVDFSRSPD-ALELNQeieferNLERFEFL- 167
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 160 tagaKYGVGFWK------PGSGIIHQIILENYA---FP--GLL----MIGTDSHTP--NGGGLGGLCIGVGGADAVdvMA 222
Cdd:PTZ00092 168 ----KWGSKAFKnllivpPGSGIVHQVNLEYLArvvFNkdGLLypdsVVGTDSHTTmiNGLGVLGWGVGGIEAEAV--ML 241
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 223 NIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFP 302
Cdd:PTZ00092 242 GQPISMVLPEVVGFKLTGKLSEHVTATDLVLTVTSMLRKRGVVGKFVEFYGPGVKTLSLADRATIANMAPEYGATMGFFP 321
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 303 FNKRMADYLASTGRS----AIAAEAGKYQGSVLTADSGAKYDQVIEINLDTLEPHINGP---------------FTPDLA 363
Cdd:PTZ00092 322 IDEKTLDYLKQTGRSeekvELIEKYLKANGLFRTYAEQIEYSDVLELDLSTVVPSVAGPkrphdrvplsdlkkdFTACLS 401
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 364 HPISKLGANAKK-----------NGYPMDIRVG-----LIGSCTNSSYED-MGRCASIAKNAMKHGLKSK--IPFNVTPG 424
Cdd:PTZ00092 402 APVGFKGFGIPEekhekkvkftyKGKEYTLTHGsvviaAITSCTNTSNPSvMLAAGLLAKKAVEKGLKVPpyIKTSLSPG 481
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 425 SEQIRATIERDGIAKTFKEFGGTVLANACGPCIGqwDRKDVKKGEKNTI---------VTSYNRNFTGRndANPATHC-F 494
Cdd:PTZ00092 482 SKVVTKYLEASGLLKYLEKLGFYTAGYGCMTCIG--NSGDLDPEVSEAItnndlvaaaVLSGNRNFEGR--VHPLTRAnY 557
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 495 VTSPELVTALSIAGTLNFNPLTDEL-TGADGKKFKLDS--PYGDE---LPQKGFDPGM--DTYEAPPsDGT----SVKV- 561
Cdd:PTZ00092 558 LASPPLVVAYALAGRVNIDFETEPLgSDKTGKPVFLRDiwPSREEiqaLEAKYVKPEMfkEVYSNIT-QGNkqwnELQVp 636
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 562 -----DVDPKSQRLQ--------LLEPFDVwngKDLTEMTVLIKVKGKCTTDHISAAGpwlkyrghldNISNN----MFI 624
Cdd:PTZ00092 637 kgklyEWDEKSTYIHnppffqtmELEPPPI---KSIENAYCLLNLGDSITTDHISPAG----------NIAKNspaaKYL 703
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 625 GATNIE------------NNEM------------NKIKNQV--------TGEWAGVPDVARFYKSKGINWVAVGDENYGE 672
Cdd:PTZ00092 704 MERGVErkdfntygarrgNDEVmvrgtfanirliNKLCGKVgpntvhvpTGEKMSIYDAAEKYKQEGVPLIVLAGKEYGS 783
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 673 GSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFAN--PADYDKVQPTSKISI-LGLNNFAPGKQLdcEIKT 749
Cdd:PTZ00092 784 GSSRDWAAKGPYLQGVKAVIAESFERIHRSNLVGMGILPLQFLNgeNADSLGLTGKEQFSIdLNSGELKPGQDV--TVKT 861
                        810       820       830
                 ....*....|....*....|....*....|....*.
gi 158297404 750 D-GKvhkiklnhSFN-------QQQIEWFKAGSALN 777
Cdd:PTZ00092 862 DtGK--------TFDtilridtEVEVEYFKHGGILQ 889
PRK00402 PRK00402
3-isopropylmalate dehydratase large subunit; Reviewed
66-491 4.76e-65

3-isopropylmalate dehydratase large subunit; Reviewed


Pssm-ID: 234748  Cd Length: 418  Bit Score: 222.74  E-value: 4.76e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  66 PLTLSEKVLYSHlddpANQDIERGvSYLRLRPDRVAMQDATAQMAMLQFISSGLKRVAVPSTIH--CDHLIEAqiggekd 143
Cdd:PRK00402   2 GMTLAEKILARH----SGRDVSPG-DIVEAKVDLVMAHDITGPLAIKEFEKIGGDKVFDPSKIVivFDHFVPA------- 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 144 laraKDINS-EVYKFLSTAGAKYGV-GFWKPGSGIIHQIILEN-YAFPGLLMIGTDSHTPNggglgglcigvggADAV-- 218
Cdd:PRK00402  70 ----KDIKSaEQQKILREFAKEQGIpNFFDVGEGICHQVLPEKgLVRPGDVVVGADSHTCT-------------YGALga 132
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 219 --------DVMANIP----WeLKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMAT 286
Cdd:PRK00402 133 fatgmgstDMAAAMAtgktW-FKVPETIKVVLEGKLPPGVTAKDVILHIIGDIGVDGATYKALEFTGETIEALSMDERMT 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 287 ICNMGAEIGATTSIFPFNKRMADYLastgrsaiaAEAGKYQGSVLTADSGAKYDQVIEINLDTLEPHINGPFTPDLAHPI 366
Cdd:PRK00402 212 LANMAIEAGAKAGIFAPDEKTLEYL---------KERAGRDYKPWKSDEDAEYEEVYEIDLSKLEPQVAAPHLPDNVKPV 282
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 367 SKLGanakknGYPMDIRVglIGSCTNSSYEDMGRCASIAKNamkHGLKSKIPFNVTPGSEQIRATIERDGIAKTFKEFGG 446
Cdd:PRK00402 283 SEVE------GTKVDQVF--IGSCTNGRLEDLRIAAEILKG---RKVAPGVRLIVIPASQKIYLQALKEGLIEIFVDAGA 351
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 158297404 447 TVLANACGPCIGqwdrkdvkkG------EKNTIVTSYNRNFTGRND--------ANPAT 491
Cdd:PRK00402 352 VVSTPTCGPCLG---------GhmgvlaPGEVCLSTTNRNFKGRMGspesevylASPAV 401
IPMI cd01583
3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and ...
99-508 3.64e-64

3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate; Aconatase-like catalytic domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes.


Pssm-ID: 153133 [Multi-domain]  Cd Length: 382  Bit Score: 218.98  E-value: 3.64e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  99 RVAMQDATAQMAMLQFISSGLKRVAVPSTIHC--DHLIEAqiggekdlaraKDINS-EVYKFLSTAGAKYGVGFWKPG-S 174
Cdd:cd01583    1 LHLVHDVTSPQAFEGLREAGREKVWDPEKIVAvfDHNVPT-----------PDIKAaEQVKTLRKFAKEFGINFFDVGrQ 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 175 GIIHQIILENYAF-PGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVIL 253
Cdd:cd01583   70 GICHVILPEKGLTlPGMTIVGGDSHTCTHGAFGAFATGIGTTDVAHVLATGKLWFRVPETMRVNVEGKLPPGVTAKDVIL 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 254 KVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLastgrsaiaAEAGKYQGSVLTA 333
Cdd:cd01583  150 YIIGKIGVDGATYKAMEFAGEAIESLSMEERMTLCNMAIEAGAKAGIVAPDETTFEYL---------KGRGKAYWKELKS 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 334 DSGAKYDQVIEINLDTLEPHINGPFTPDLAHPISKLGanakknGYPMDIRVglIGSCTNSSYEDMGRCASIAKnamKHGL 413
Cdd:cd01583  221 DEDAEYDKVVEIDASELEPQVAWPHSPDNVVPVSEVE------GIKIDQVF--IGSCTNGRLEDLRAAAEILK---GRKV 289
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 414 KSKIPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIG-QWDRkdVKKGEknTIVTSYNRNFTGR-NDANPAT 491
Cdd:cd01583  290 ADGVRLIVVPASQRVYKQAEKEGLIEIFIEAGAEVRPPGCGACLGgHMGV--LAPGE--RCVSTSNRNFKGRmGSPGARI 365
                        410
                 ....*....|....*..
gi 158297404 492 HcfVTSPELVTALSIAG 508
Cdd:cd01583  366 Y--LASPATAAASAITG 380
PLN00070 PLN00070
aconitate hydratase
96-760 4.98e-60

aconitate hydratase


Pssm-ID: 215047 [Multi-domain]  Cd Length: 936  Bit Score: 219.29  E-value: 4.98e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  96 RPDRVAMQDATAQMAM--LQFISSGLKRVA---------VPSTIHCDHLIEAQIGGEKDLARAK-----DINSEVYKFLs 159
Cdd:PLN00070 121 KPARVLLQDFTGVPAVvdLACMRDAMNNLGgdpnkinplVPVDLVIDHSVQVDVARSENAVQANmelefQRNKERFAFL- 199
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 160 tagaKYGVGFWK------PGSGIIHQIILENYA-----FPGLL----MIGTDSHTPNGGGLGGLCIGVGGADAVDVMANI 224
Cdd:PLN00070 200 ----KWGSTAFQnmlvvpPGSGIVHQVNLEYLGrvvfnTDGILypdsVVGTDSHTTMIDGLGVAGWGVGGIEAEAAMLGQ 275
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 225 PWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFN 304
Cdd:PLN00070 276 PMSMVLPGVVGFKLSGKLRDGVTATDLVLTVTQMLRKHGVVGKFVEFYGEGMSELSLADRATIANMSPEYGATMGFFPVD 355
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 305 KRMADYLASTGRSaiaAEAGKYQGSVLTAD----------SGAKYDQVIEINLDTLEPHINGPFTPDLAHPI-------- 366
Cdd:PLN00070 356 HVTLQYLKLTGRS---DETVAMIEAYLRANkmfvdynepqQERVYSSYLELDLEDVEPCISGPKRPHDRVPLkemkadwh 432
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 367 ----SKLG--------------ANAKKNGYPMDIRVG-----LIGSCTNSSYED-MGRCASIAKNAMKHGLKSK--IPFN 420
Cdd:PLN00070 433 scldNKVGfkgfavpkeaqskvAKFSFHGQPAELRHGsvviaAITSCTNTSNPSvMLGAGLVAKKACELGLEVKpwIKTS 512
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 421 VTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCI---GQWDRKDVKKGEKNTIVT----SYNRNFTGRndANPATHC 493
Cdd:PLN00070 513 LAPGSGVVTKYLLKSGLQKYLNQQGFHIVGYGCTTCIgnsGELDESVASAITENDIVAaavlSGNRNFEGR--VHPLTRA 590
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 494 -FVTSPELVTALSIAGTLNFNPLTDEL-TGADGKK--FKLDSPYGDELP---QKGFDPGM--DTYEA---------PPSD 555
Cdd:PLN00070 591 nYLASPPLVVAYALAGTVDIDFEKEPIgTGKDGKDvfFRDIWPSNEEVAevvQSSVLPDMfkSTYEAitkgnpmwnQLSV 670
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 556 GTSVKVDVDPKSQRLQllEP-------FDVWNGKDLTEMTVLIKVKGKCTTDHISAAG------PWLKY----------- 611
Cdd:PLN00070 671 PSGTLYSWDPKSTYIH--EPpyfknmtMSPPGPHGVKDAYCLLNFGDSITTDHISPAGsihkdsPAAKYlmergvdrkdf 748
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 612 ------RGHLDNISNNMFigaTNIEnnEMNK-IKNQV--------TGEWAGVPDVARFYKSKGINWVAVGDENYGEGSSR 676
Cdd:PLN00070 749 nsygsrRGNDEIMARGTF---ANIR--IVNKlLKGEVgpktvhipTGEKLSVFDAAMKYKSEGHDTIILAGAEYGSGSSR 823
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 677 EHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFAN-------------------PADYDKVQPTSKISILGLNnf 737
Cdd:PLN00070 824 DWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSgedadtlgltgherytidlPSNISEIKPGQDVTVTTDN-- 901
                        810       820
                 ....*....|....*....|...
gi 158297404 738 apGKQLDCEIKTDGKVHKIKLNH 760
Cdd:PLN00070 902 --GKSFTCTLRFDTEVELAYFDH 922
LeuC COG0065
Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism] ...
65-510 4.17e-58

Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism];


Pssm-ID: 223143  Cd Length: 423  Bit Score: 203.97  E-value: 4.17e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  65 RPLTLSEKVLYSH----LDDPANQDIergvsylrLRPDRVAMQDATAQMAMLQFISSGlKRVAVPSTIHC--DHLIEAqi 138
Cdd:COG0065    1 SAKTLYEKILDAHvgkeEVGAGETVL--------LYIDLHLVHDVTSPQAFEGLREAG-RKVRDPEKTVAtfDHNVPT-- 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 139 ggeKDLARAKDINsEVYKFLSTAGAKYgvgFWKPGS-GIIHQIILEN-YAFPGLLMIGTDSHTPNGGGLGGLCIGVGGAD 216
Cdd:COG0065   70 ---PDIKAAEQQK-ELRENAKEFGIVN---FYDVGDqGIVHQVGPEQgLTLPGMTIVGGDSHTCTHGAFGAFAFGIGTTD 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 217 AVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGA 296
Cdd:COG0065  143 VAHVLATGKLWFRVPKTMKVEVEGKLPPGVTAKDIILALIGKIGVDGGTGYAIEFAGEAIRSLSMEGRMTLCNMAIEAGA 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 297 TTSIFPFNKRMADYLAstgrsaiAAEAGKYQGSVLTADSGAKYDQVIEINLDTLEPHINGPFTPDLAHPISKLGanakkn 376
Cdd:COG0065  223 KAGIIAPDETTFEYLK-------EWDGAVAYWKTLKSDEDAVYDKVVELDASDLEPQVAWPTNPDNVVPVSEVE------ 289
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 377 gyPMDIRVG--LIGSCTNSSYEDMGRCASIAKnamKHGLKSKIPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACG 454
Cdd:COG0065  290 --PDPIKIDqvFIGSCTNGRIEDLRAAAEILK---GRKVAPGVRAIVVPGSRRVKEQAEKEGLDKIFIEAGFEWREPGCG 364
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 158297404 455 PCIGqwdRKDVKKGEKNTIVTSYNRNFTGRNdANPATHCFVTSPELVTALSIAGTL 510
Cdd:COG0065  365 PCLG---MHPGVLGPGERCASTSNRNFEGRQ-GSPGARTYLASPAMAAAAAVEGEI 416
Aconitase_C pfam00694
Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This ...
587-717 8.85e-53

Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This domain undergoes conformational change in the enzyme mechanism.


Pssm-ID: 395564 [Multi-domain]  Cd Length: 131  Bit Score: 179.10  E-value: 8.85e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  587 MTVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNIENNEMNKIKNQVTGEWAGVPDVARFYKSKGINWVAVG 666
Cdd:pfam00694   1 MARFLTLKGLTTPDFNSNVDTDLIIPKQFLGTIANIGIGNINFEGWRAGKTTHLPDGENPDFYDAAERYKQHGAPIVVIA 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 158297404  667 DENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANP 717
Cdd:pfam00694  81 GKNYGCGSSREHAAWALRDLGIKAVIAESFARIHRNNLIKNGLLPLEFPRE 131
AcnA_IRP cd01586
Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA ...
99-509 7.79e-44

Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydrolyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes.


Pssm-ID: 153136  Cd Length: 404  Bit Score: 163.24  E-value: 7.79e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  99 RVAMQDATAQMAMLQFIS--SGLKRV---------AVPSTIHCDHLIEAQIGGEKDlARAKDI------NSEVYKFLSTA 161
Cdd:cd01586    1 RVILQDFTGVPAVVDLAAmrDAVKRLggdpekinpLIPVDLVIDHSVQVDFYGTAD-ALAKNMkleferNRERYEFLKWG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 162 GAKYG-VGFWKPGSGIIHQIILE--------------NYAFPGLLmIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPW 226
Cdd:cd01586   80 QKAFKnLRVVPPGTGIIHQVNLEylarvvftseedgdGVAYPDSV-VGTDSHTTMINGLGVLGWGVGGIEAEAVMLGQPI 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 227 ELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNkr 306
Cdd:cd01586  159 SMLLPEVVGVKLTGKLRPGVTATDLVLTVTQMLRKVGVVGKFVEFFGPGVAKLSVADRATIANMAPEYGATCGFFPVD-- 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 307 madylastgrsaiaaeagkyqgsvltadsgakyDQVIEINLDTLEPHINGPFTPDLAHPIsklganakkNGypmDIRVGL 386
Cdd:cd01586  237 ---------------------------------TQVVELDLSTVEPSVSGPKRPQDRVPL---------HG---SVVIAA 271
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 387 IGSCTNSSYED-MGRCASIAKNAMKHGLKSK--IPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQ---W 460
Cdd:cd01586  272 ITSCTNTSNPSvMLAAGLLAKKAVELGLKVKpyVKTSLAPGSRVVTKYLEASGLLPYLEKLGFHVVGYGCTTCIGNsgpL 351
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....
gi 158297404 461 DRKDVKKGEKNTIVT----SYNRNFTGRndANPATHC-FVTSPELVTALSIAGT 509
Cdd:cd01586  352 PEEVEEAIKENDLVVaavlSGNRNFEGR--IHPLVRAnYLASPPLVVAYALAGT 403
h_aconitase TIGR00139
homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is ...
66-712 1.48e-42

homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is part of an unusual lysine biosynthesis pathway. Because this model is based on just two sequences from a narrow taxonomic range, it may not recognize distant orthologs, should any exist. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures, but 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble leuC and leuD over their lengths but are even closer to the respective domains of homoaconitase, and their identity is uncertain. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 129245 [Multi-domain]  Cd Length: 712  Bit Score: 165.60  E-value: 1.48e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404   66 PLTLSEKVLYSH-LDDPANQDIERGvSYLRLRPDRVAMQDATAQMAmLQFISSGLKRVAVPSTI--HCDHlieaqiggek 142
Cdd:TIGR00139   1 GQNLTEKIVQKYaVGLPEGKFVHSG-DYVSIKPAHCMSHDNSWPCA-LKFMGIGASKIHNPDQIvmTLDH---------- 68
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  143 DLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILEN-YAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVM 221
Cdd:TIGR00139  69 DIQNKSDKNLKKYKNIEEFAKKHGIDFYPAGRGIGHQIMIEEgFAFPGNLAVASDSHSNMYGGLGCLGTPIVRTDAAAIW 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  222 ANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNG--VDSISCTGMATICNMGAEIGATTS 299
Cdd:TIGR00139 149 ATGKTWWQIPPVAKVEFKGQLPPGVSGKDIIVALCGLFNKDDVLNHAIEFTGSEdsLNALPIDHRLTIANMTTEWGALSG 228
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  300 IFPFNKRMADYLasTGRSAIAA-----------EAGKYQGSVL--------TADSGAKYDQVIEINLDTLEPHINGPFTP 360
Cdd:TIGR00139 229 LFPIDKTLIDWL--KGKATLAAlgladgpfinpAAERFTHPALeekaeiplKADKDAHYAKELFIDLASLSHYVSGPNSV 306
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  361 DLAHPISKLGANakkngypmDIRV--GLIGSCTNSSYEDMGRCASIAKNAM-KHGLK-----SKIPFNVTPGSEQIRATI 432
Cdd:TIGR00139 307 KVANPLKDLEAQ--------DIKIdkAYLVSCTNSRASDIAAAADVFCEAAdKNGGKinkiaPGVEFYIAAASIEEEAAA 378
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  433 ERDGIAKTFKEFGGTVLANACGPCIGQwDRKDVKKGEKNtiVTSYNRNFTGRNDANPAThCFVTSPELVTALSIAGTLNf 512
Cdd:TIGR00139 379 EGNGAWEKLLEAGAIPLPAGCGPCIGL-GAGLLEPGEVG--ISASNRNFKGRMGSKDAK-AYLASPAVVAASALLGKIS- 453
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  513 NPltDELTGADGKKfklDSPYGDELPQKGFDPGMDTYEAPPSDGTSVKVDVDPKSQRLQLLEPFDVWNGKDLTEMTVLI- 591
Cdd:TIGR00139 454 GP--AEVLSPEGWT---EIIFGEGDGIKEEDRMLTNEEALEKIIGIIDDLVADEEKNAASEAPAQEESEQGLTEILEGFp 528
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  592 -KVKGK---CTTDHISAAGPWLKYRGHLDNISNNMfIGATNIENNEmnkiknqvtgewagvpdvARFYKSKGINWVAVGD 667
Cdd:TIGR00139 529 eEFSGElvfCDADNINTDGIYPGKYTYQDDVPKEK-MAQVCMENYD------------------AEFRTKAHEGDILVSG 589
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|....*
gi 158297404  668 ENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPL 712
Cdd:TIGR00139 590 FNFGCGSSREQAATAILAKGINLVVSGSFGNIFSRNSINNALLGL 634
Homoaconitase cd01582
Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase ...
112-510 1.05e-30

Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase catalytic domain. Homoaconitase and other uncharacterized proteins of the Aconitase family. Homoaconitase is part of an unusual lysine biosynthesis pathway found only in filamentous fungi, in which lysine is synthesized via the alpha-aminoadipate pathway. In this pathway, homoaconitase catalyzes the conversion of cis-homoaconitic acid into homoisocitric acid. The reaction mechanism is believed to be similar to that of other aconitases.


Pssm-ID: 153132  Cd Length: 363  Bit Score: 124.26  E-value: 1.05e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 112 LQFISSGLKRVAVPSTIHC--DHlieaqiggekDLARAKDINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILEN-YAFP 188
Cdd:cd01582   13 LKFMSIGATKIHNPDQIVMtlDH----------DVQNKSEKNLKKYKNIESFAKKHGIDFYPAGRGIGHQIMIEEgYAFP 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 189 GLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAI 268
Cdd:cd01582   83 GTLAVASDSHSNMYGGVGCLGTPIVRTDAAAIWATGQTWWQIPPVAKVELKGQLPKGVTGKDVIVALCGLFNKDQVLNHA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 269 VEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNkrmadylastgrsaiaaeagkyqgsvltadsgAKYdqvIEINLD 348
Cdd:cd01582  163 IEFTGSGLNSLSVDTRLTIANMTTEWGALSGLFPTD--------------------------------AKH---LILDLS 207
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 349 TLEPHINGPFTPDLAHPISKLGANAKKngypmdIRVGLIGSCTNSSYEDMGRCASIAK-NAMKHGLKSKIP---FNVTPG 424
Cdd:cd01582  208 TLSPYVSGPNSVKVSTPLKELEAQNIK------INKAYLVSCTNSRASDIAAAADVVKgKKEKNGKIPVAPgveFYVAAA 281
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 425 SEQIRATIERDGIAKTFKEFGGTVLANACGPCIGqWDRKDVKKGEKNtiVTSYNRNFTGRNdANPATHCFVTSPELVTAL 504
Cdd:cd01582  282 SSEVQAAAEKNGDWQTLLEAGATPLPAGCGPCIG-LGQGLLEPGEVG--ISATNRNFKGRM-GSTEALAYLASPAVVAAS 357

                 ....*.
gi 158297404 505 SIAGTL 510
Cdd:cd01582  358 AISGKI 363
PRK05478 PRK05478
3-isopropylmalate dehydratase large subunit;
231-510 2.18e-29

3-isopropylmalate dehydratase large subunit;


Pssm-ID: 235490  Cd Length: 466  Bit Score: 122.54  E-value: 2.18e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 231 PNVIGVKLTGKISGWTSPKDVILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGA---------TTsif 301
Cdd:PRK05478 163 PKTMKIEVDGKLPPGVTAKDIILAIIGKIGTAGGTGYVIEFAGEAIRALSMEGRMTICNMSIEAGAraglvapdeTT--- 239
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 302 pFnkrmaDYLAstGRsAIAAEAGKYQGSV-----LTADSGAKYDQVIEINLDTLEPH------------INGPF-TPDLA 363
Cdd:PRK05478 240 -F-----EYLK--GR-PFAPKGEDWDKAVaywktLKSDEDAVFDKVVTLDAADIEPQvtwgtnpgqvisIDGKVpDPEDF 310
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 364 HPISKLGANAK-------KNGYPM-DIRVG--LIGSCTNSSYEDMGRCASIAKNamkhglkSKIPFNVT----PGSEQIR 429
Cdd:PRK05478 311 ADPVKRASAERalaymglKPGTPItDIKIDkvFIGSCTNSRIEDLRAAAAVVKG-------RKVAPGVRalvvPGSGLVK 383
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 430 ATIERDGIAKTFKEFG------GtvlanaCGPCIGQWDRKdVKKGEKnTIVTSyNRNFTGRNDANPATHcfVTSPELVTA 503
Cdd:PRK05478 384 AQAEAEGLDKIFIEAGfewrepG------CSMCLAMNPDK-LPPGER-CASTS-NRNFEGRQGKGGRTH--LVSPAMAAA 452

                 ....*..
gi 158297404 504 LSIAGTL 510
Cdd:PRK05478 453 AAITGHF 459
AcnA_Bact_Swivel cd01579
Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) ...
592-731 2.20e-29

Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism. This distinct subfamily is found only in bacteria and archea. Its exact characteristics are not known.


Pssm-ID: 238811 [Multi-domain]  Cd Length: 121  Bit Score: 112.92  E-value: 2.20e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 592 KVKGKCTTDHISAAGP-WLKYRGHLDNISNNMFIGATniennemnkiknqvtgewagvPDVARFYKSKGINWVaVGDENY 670
Cdd:cd01579    1 KVGDNITTDHIMPAGAkVLPLRSNIPAISEFVFHRVD---------------------PTFAERAKAAGPGFI-VGGENY 58
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 158297404 671 GEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKVQPTSKISI 731
Cdd:cd01579   59 GQGSSREHAALAPMYLGVRAVLAKSFARIHRANLINFGILPLTFADEDDYDRFEQGDQLEL 119
PRK12466 PRK12466
3-isopropylmalate dehydratase large subunit;
172-510 2.77e-28

3-isopropylmalate dehydratase large subunit;


Pssm-ID: 183543  Cd Length: 471  Bit Score: 119.24  E-value: 2.77e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 172 PGSGIIHQIILE-NYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMANIPWELKCPNVIGVKLTGKISGWTSPKD 250
Cdd:PRK12466 105 PRQGIVHVVAPElGLTLPGMVIVCGDSHTTTYGALGALAFGIGTSEVEHVLATQTLVYRKPKTMRVRVDGELPPGVTAKD 184
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 251 VILKVADILTVKGGTGAIVEYMGNGVDSISCTGMATICNMGAEIGATTSIFPFNKRMADYLAstGR----SAIAAEAGKY 326
Cdd:PRK12466 185 LILALIARIGADGATGYAIEFAGEAIRALSMEGRMTLCNMAVEAGARGGLIAPDETTFDYLR--GRprapKGALWDAALA 262
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 327 QGSVLTADSGAKYDQVIEINLDTLEPHINGPFTPDLAHPIS-------------KLGANAKKNGYpMDIRVG-------- 385
Cdd:PRK12466 263 YWRTLRSDADAVFDREVEIDAADIAPQVTWGTSPDQAVPITgrvpdpaaeadpaRRAAMERALDY-MGLTPGtplagipi 341
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 386 ---LIGSCTNSSYEDMGRCASIAKnamkhGLKSKIPFN--VTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQW 460
Cdd:PRK12466 342 drvFIGSCTNGRIEDLRAAAAVLR-----GRKVAPGVRamVVPGSGAVRRQAEAEGLARIFIAAGFEWREPGCSMCLAMN 416
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|
gi 158297404 461 DRKdVKKGEKntIVTSYNRNFTGRNDANPATHcfVTSPELVTALSIAGTL 510
Cdd:PRK12466 417 DDV-LAPGER--CASTTNRNFEGRQGPGARTH--LMSPAMVAAAAVAGHI 461
PRK11413 PRK11413
putative hydratase; Provisional
58-777 1.27e-27

putative hydratase; Provisional


Pssm-ID: 183125 [Multi-domain]  Cd Length: 751  Bit Score: 119.34  E-value: 1.27e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404  58 VVKKRLGRPLTLSEKVLYSHLDDPANQDiergvsyLRLRPDRVAMQDAT----AQMAmlqfISSGLKRVAVPSTIHCDHL 133
Cdd:PRK11413  26 EIKKEEAKKGTIAWSILSSHNTSGNMDK-------LKIKFDSLASHDITfvgiIQTA----KASGMERFPLPYVLTNCHN 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 134 IEAQIGGEkdlarakdINSEVYKFLSTAGAKYGVGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTpnggglgglcigvg 213
Cdd:PRK11413  95 SLCAVGGT--------INEDDHVFGLSAAQKYGGIFVPPHIAVIHQYMREMMAGGGKMILGSDSHT-------------- 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 214 GADAVDVMA-------------NIPWELKCPNVIGVKLTGKISGWTSPKDVILkvADILTV-KGG--TGAIVEYMGNGVD 277
Cdd:PRK11413 153 RYGALGTMAvgegggelvkqllNDTYDIDYPGVVAVYLTGKPAPGVGPQDVAL--AIIGAVfKNGyvKNKVMEFVGPGVS 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 278 SISCTGMATICNMGAEIGATTSIFPFNKRMADYLASTGRSAIAAEagkyqgsvLTADSGAKYDQVIEINLDTLEPHINGP 357
Cdd:PRK11413 231 ALSTDFRNGVDVMTTETTCLSSIWQTDEEVHNWLALHGRGQDYCE--------LNPQPMAYYDGCISVDLSAIKPMIALP 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 358 FTPDLAHPISKLGANAK--------------------------KNGypmDIRV--GLIGSCTNSSYEDMGRCASIaknam 409
Cdd:PRK11413 303 FHPSNVYEIDELNQNLTdilreveieservahgkaklslldkiENG---RLKVqqGIIAGCSGGNYENVIAAANA----- 374
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 410 khgLKSK------IPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDrkdvkkgekntivTSYN----- 478
Cdd:PRK11413 375 ---LRGQscgndtFSLSVYPSSQPVFMDLAKKGVVADLMGAGAIIRTAFCGPCFGAGD-------------TPANnglsi 438
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 479 ----RNFTGRNDANPATHCfVTSPELVTALSIAGTLNFNPLtdeLTGADGkkfkLDSPYgdELPQKGFDPGMdtYEAPPS 554
Cdd:PRK11413 439 rhttRNFPNREGSKPANGQ-MSAVALMDARSIAATAANGGY---LTSATE----LDCWD--NVPEYAFDVTP--YKNRVY 506
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 555 DGTsVKVDvdpKSQRLQlLEPfdvwNGKDLTEM-----TVLIKVKGK-----CTTDHISAAGPWLKYRghldniSNNM-- 622
Cdd:PRK11413 507 QGF-GKGA---TQQPLI-YGP----NIKDWPEMgaltdNILLKVCSKildpvTTTDELIPSGETSSYR------SNPLgl 571
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 623 -----------FIGATNiENNEMNkiKNQVTGEWAGVPDV-ARFYKSKGINWVA-----VGDENY----GEGSSREHAAL 681
Cdd:PRK11413 572 aeftlsrrdpgYVGRSK-AVAELE--NQRLAGNVSELTEVfARIKQIAGQEHIDplqteIGSMVYavkpGDGSAREQAAS 648
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 682 EPRHLGARAIITKSFA-RIHETNLKKQGLLPLTFANPADYDKVQ----PTSKISILGLNNFAPGKQldceIKTDGKVHKI 756
Cdd:PRK11413 649 CQRVLGGLANIAEEYAtKRYRSNVINWGMLPFQMAEEPTFEVGDyiyiPGIRAALDNPGTTFKGYV----IHEDAPVTEI 724
                        810       820
                 ....*....|....*....|..
gi 158297404 757 KLN-HSFNQQQIEWFKAGSALN 777
Cdd:PRK11413 725 TLYmESLTAEEREIIKAGCLIN 746
Aconitase_swivel cd00404
Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible ...
592-733 2.36e-25

Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. The aconitase family contains the following proteins: - Iron-responsive element binding protein (IRE-BP). IRE-BP is a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 238236 [Multi-domain]  Cd Length: 88  Bit Score: 100.24  E-value: 2.36e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 592 KVKGKCTTDHISAAGPWlkyrghldnisnnmfigatniennemnkiknqvtgewagvpdvarfykskginwVAVGDENYG 671
Cdd:cd00404    1 KVAGNITTDHISPAGPG------------------------------------------------------VVIGDENYG 26
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 158297404 672 EGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKVQPTSKISILG 733
Cdd:cd00404   27 TGSSREHAALELRLLGGRAVIAKSFARIFFRNLVDQGLLPLEFADPEDYLKLHTGDELDIYP 88
AcnA_IRP_Swivel cd01580
Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, ...
598-733 1.94e-18

Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238812 [Multi-domain]  Cd Length: 171  Bit Score: 83.48  E-value: 1.94e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 598 TTDHISAAG------PWLKY-------------------------RGHLDNISN-NMFIGATniennEMNKIKNQVTGEW 645
Cdd:cd01580    7 TTDHISPAGsiakdsPAGKYlaergvkprdfnsygsrrgndevmmRGTFANIRLrNKLVPGT-----EGGTTHHPPTGEV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 646 AGVPDVARFYKSKGINWVAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANP--ADYDKV 723
Cdd:cd01580   82 MSIYDAAMRYKEEGVPLVILAGKEYGSGSSRDWAAKGPFLLGVKAVIAESFERIHRSNLVGMGILPLQFPPGenADSLGL 161
                        170
                 ....*....|
gi 158297404 724 QPTSKISILG 733
Cdd:cd01580  162 TGEETYDIIG 171
IPMI_Swivel cd01577
Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized ...
652-731 1.28e-13

Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238809 [Multi-domain]  Cd Length: 91  Bit Score: 66.84  E-value: 1.28e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 652 ARFYKSkginwVAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYD-KVQPTSKIS 730
Cdd:cd01577   14 ARFLGD-----IIVAGKNFGCGSSREHAPWALKDAGIRAVIAESFARIFFRNAINNGLLPVTLADEDVEEvEAKPGDEVE 88

                 .
gi 158297404 731 I 731
Cdd:cd01577   89 V 89
AcnB COG1049
Aconitase B [Energy production and conversion];
157-561 1.49e-12

Aconitase B [Energy production and conversion];


Pssm-ID: 223978 [Multi-domain]  Cd Length: 852  Bit Score: 71.32  E-value: 1.49e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 157 FLSTAGakyGVGFwKPGSGIIHQIiLENYAFPGLLMIGTDSHT--PNGGGLGGLCIGVGGADAVDVMAnipweLKCPNVI 234
Cdd:COG1049  454 FIMNRG---GVSL-RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFAAATGVMP-----LDMPESV 523
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 235 GVKLTGKISGWTSPKDVILKVA------DILTVKGG------TGAIVEYmgNGVDSISCTGMATICNMGAEIGATTSIFP 302
Cdd:COG1049  524 LVRFKGEMQPGITLRDLVHAIPyyaikqGLLTVEKKgkknifSGRILEI--EGLPDLKVEQAFELTDASAERSAAGCTIK 601
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 303 FNKR-MADYLAST------------------GRSAIAAEAGKYQGSVLTADSGAKYDQVIEINLDTL-EPHINGPFTPDL 362
Cdd:COG1049  602 LNKEpIIEYLKSNivllkwmiaegygdartlERRIDKMEAWLANPELLEADADAEYAAVIEIDLADIkEPILAAPNDPDD 681
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 363 AHPISKLGANakkngypmDIRVGLIGSC-TNssyedMGRCASIAKNAMKHGLKSKIPFNVTPGSEQIRATIERDGIAKTF 441
Cdd:COG1049  682 VRLLSEVAGD--------KIDEVFIGSCmTN-----IGHFRAAGKLLENAKGELPTRLWVAPPTKMDAAQLTEEGYYSIF 748
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 442 KEFGGTVLANACGPCIGQWDRkdVKKGEknTIVTSYNRNFTGR--NDANpathCFVTSPELVTALSIAGTLnfnPLTDEL 519
Cdd:COG1049  749 GKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKGAN----VYLASAELAAVCAILGKI---PTVEEY 817
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|..
gi 158297404 520 TGADGkkfKLDSPYGDELPQKGFDPgMDTYeapPSDGTSVKV 561
Cdd:COG1049  818 MAYVA---KIDKQADDIYRYLNFNQ-IENY---TEKADSVIF 852
LeuD COG0066
3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];
663-731 4.21e-11

3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];


Pssm-ID: 223144 [Multi-domain]  Cd Length: 191  Bit Score: 62.61  E-value: 4.21e-11
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 158297404 663 VAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYDKVQ--PTSKISI 731
Cdd:COG0066   65 ILVAGENFGCGSSREHAPWALKDYGIRAVIAPSFADIFYRNAINNGLLPIVLAEEDVTELFEdvPGDEVTV 135
AcnB cd01581
Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA ...
157-510 1.99e-10

Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle; Aconitase B catalytic domain. Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle. Aconitase has an active (4FE-4S) and an inactive (3FE-4S) form. The active cluster is part of the catalytic site that interconverts citrate, cis-aconitase and isocitrate. The domain architecture of aconitase B is different from other aconitases in that the catalytic domain is normally found at C-terminus for other aconitases, but it is at N-terminus for B family. It also has a HEAT domain before domain 4 which plays a role in protein-protein interaction. This alignment is the core domain including domains 1,2 and 3.


Pssm-ID: 153131  Cd Length: 436  Bit Score: 63.67  E-value: 1.99e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 157 FLSTAGakyGVGFwKPGSGIIHQIiLENYAFPGLLMIGTDSHT--PNGGGLGGLCIGVGGADAVDVMAnipweLKCPNVI 234
Cdd:cd01581   80 FISNRG---GVAL-RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFAAATGVMP-----LDMPESV 149
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 235 GVKLTGKISGWTSPKDVILKV------ADILTV--KGG----TGAIVEYmgNGVDSISCTGMATICNMGAEIGATTSIFP 302
Cdd:cd01581  150 LVRFKGKMQPGITLRDLVNAIpyyaiqQGLLTVekKGKknvfNGRILEI--EGLPDLKVEQAFELTDASAERSAAACTVR 227
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 303 FNKR-MADYLAS------------------TGRSAIAAEAGKYQGSVLTADSGAKYDQVIEINLDTL-EPHINGPFTPDL 362
Cdd:cd01581  228 LDKEpVIEYLESnvvlmkimiangyddartLLRRIIAMEEWLANPPLLEPDADAEYAAVIEIDLDDIkEPILACPNDPDD 307
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 363 AHPISKLGANAkkngypmdIRVGLIGSC-TNssyedMGRCASIAKnaMKHGLKSKIP-FNVTPGSEQIRATIERDGIAKT 440
Cdd:cd01581  308 VKLLSEVAGKK--------IDEVFIGSCmTN-----IGHFRAAAK--ILRGKEFKPTrLWVAPPTRMDWAILQEEGYYSI 372
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 158297404 441 FKEFGGTVLANACGPCIGQWDRkdVKKGEknTIVTSYNRNFTGR--NDANpathCFVTSPELVTALSIAGTL 510
Cdd:cd01581  373 FGDAGARTEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFDNRvgKGAE----VYLGSAELAAVCALLGRI 436
leuD PRK00439
3-isopropylmalate dehydratase small subunit; Reviewed
665-713 5.81e-09

3-isopropylmalate dehydratase small subunit; Reviewed


Pssm-ID: 234762 [Multi-domain]  Cd Length: 163  Bit Score: 55.60  E-value: 5.81e-09
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 158297404 665 VGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLT 713
Cdd:PRK00439  53 VAGKNFGCGSSREHAPIALKAAGVSAVIAKSFARIFYRNAINIGLPVLE 101
PRK09238 PRK09238
bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated
331-510 7.74e-09

bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated


Pssm-ID: 236424 [Multi-domain]  Cd Length: 835  Bit Score: 59.04  E-value: 7.74e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 331 LTADSGAKYDQVIEINLDTL-EPHINGPFTPDLAHPISKLGANAkkngypmdIRVGLIGSC-TNssyedMGRCASIAKNA 408
Cdd:PRK09238 647 LEADADAEYAAVIEIDLAEIkEPILACPNDPDDVRLLSEVAGTK--------IDEVFIGSCmTN-----IGHFRAAGKLL 713
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 409 MKHGLKSKIPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGPCIGQWDRkdVKKGEknTIVTSYNRNFTGR--ND 486
Cdd:PRK09238 714 EGKKGQLPTRLWVAPPTKMDADQLTEEGYYSIFGKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKG 789
                        170       180
                 ....*....|....*....|....
gi 158297404 487 ANpathCFVTSPELVTALSIAGTL 510
Cdd:PRK09238 790 AN----VYLGSAELAAVCALLGRI 809
PLN00094 PLN00094
aconitate hydratase 2; Provisional
171-518 1.25e-08

aconitate hydratase 2; Provisional


Pssm-ID: 215053 [Multi-domain]  Cd Length: 938  Bit Score: 58.78  E-value: 1.25e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 171 KPGSGIIHQIiLENYAFPGLLMIGTDSHT--PNGGGLGGLCIGVGGADAVDVMAnipweLKCPNVIGVKLTGKISGWTSP 248
Cdd:PLN00094 536 RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFGAATGVIP-----LDMPESVLVRFTGTMQPGITL 609
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 249 KDVILKV------ADILTV-KGG-----TGAIVEYmgNGVDSISCTGMATICNMGAEIGATTSIFPFNKR-MADYLAST- 314
Cdd:PLN00094 610 RDLVHAIpytaiqDGLLTVeKKGkknvfSGRILEI--EGLPHLKCEQAFELSDASAERSAAGCTIKLDKEpIIEYLNSNv 687
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 315 -----------------GRSAIAAEAGKYQGSVLTADSGAKYDQVIEINLDTL-EPHINGPFTPDLAHPISKLGANakkn 376
Cdd:PLN00094 688 vmlkwmiaegygdrrtlERRIARMQQWLADPELLEADPDAEYAAVIEIDMDEIkEPILCAPNDPDDARLLSEVTGD---- 763
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158297404 377 gypmDIRVGLIGSC-TNssyedMGRCASIAKNAMKHGLKSKIPFNVTPGSEQIRATIERDGIAKTFKEFGGTVLANACGP 455
Cdd:PLN00094 764 ----KIDEVFIGSCmTN-----IGHFRAAGKLLNDNLSQLPTRLWVAPPTKMDEAQLKAEGYYSTFGTVGARTEMPGCSL 834
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 158297404 456 CIGQWDRkdvkKGEKNTIVTSYNRNFTGRndANPATHCFVTSPELVTALSIAGTLnfnPLTDE 518
Cdd:PLN00094 835 CMGNQAR----VAEKSTVVSTSTRNFPNR--LGKGANVYLASAELAAVAAILGRL---PTVEE 888
PRK14023 PRK14023
homoaconitate hydratase small subunit; Provisional
649-713 1.47e-08

homoaconitate hydratase small subunit; Provisional


Pssm-ID: 184460 [Multi-domain]  Cd Length: 166  Bit Score: 54.81  E-value: 1.47e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 158297404 649 PDVARFYKSKGInwvAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLT 713
Cdd:PRK14023  41 PEFASTVRPGDI---LVAGRNFGLGSSREYAPEALKMLGIGAIIAKSYARIFYRNLVNLGIPPFE 102
LEUD_arch TIGR02087
3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the ...
663-721 2.55e-08

3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the 3-isopropylmalate dehydratase, small subunits which form TIGR00171. This subfamily includes the members of TIGR02084 which are gene clustered with other genes of leucine biosynthesis. The rest of the subfamily includes mainly archaeal species which exhibit two hits to this model. In these cases it is possible that one or the other of the hits does not have a 3-isopropylmalate dehydratase activity but rather one of the other related aconitase-like activities.


Pssm-ID: 273961 [Multi-domain]  Cd Length: 154  Bit Score: 53.58  E-value: 2.55e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 158297404  663 VAVGDENYGEGSSREHAALEPRHLGARAIITKSFARIHETNLKKQGLLPLTFANPADYD 721
Cdd:TIGR02087  50 VIVAGKNFGCGSSREQAALALKAAGIAAVIAESFARIFYRNAINIGLPLIEAKTEGIKD 108
leuD PRK01641
3-isopropylmalate dehydratase small subunit;
665-724 5.60e-07

3-isopropylmalate dehydratase small subunit;


Pssm-ID: 179314 [Multi-domain]  Cd Length: 200  Bit Score: 50.90  E-value: 5.60e-07
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 158297404 665 VGDENYGEGSSREHA--ALEprHLGARAIITKSFARIHETNLKKQGLLPLTfANPADYDKVQ 724
Cdd:PRK01641  72 LAGDNFGCGSSREHApwALA--DYGFRAVIAPSFADIFYNNCFKNGLLPIV-LPEEDVDELF 130
PLN00072 PLN00072
3-isopropylmalate isomerase/dehydratase small subunit; Provisional
663-699 5.67e-05

3-isopropylmalate isomerase/dehydratase small subunit; Provisional


Pssm-ID: 177701 [Multi-domain]  Cd Length: 246  Bit Score: 45.23  E-value: 5.67e-05
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 158297404 663 VAVGDENYGEGSSREHAALEPRHLGARAIITKSFARI 699
Cdd:PLN00072 132 IIIGGENFGCGSSREHAPVALGAAGAKAVVAESYARI 168
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH