NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|958755513|ref|XP_014713508|]
View 

PREDICTED: LOW QUALITY PROTEIN: transmembrane protein 132C, partial [Equus asinus]

Protein Classification

TMEM132 and TMEM132D_C domain-containing protein (domain architecture ID 12176535)

TMEM132 and TMEM132D_C domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
6-347 0e+00

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


:

Pssm-ID: 339594  Cd Length: 342  Bit Score: 577.26  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513    6 ILNTAILTGKTVAMPIKVVSVEENGVVTDISEAVECKSTDEDVIKVSDRCDYVFVNGKEMKGKVETVVNFTYQHLSAPLH 85
Cdd:pfam16070   2 LLNTAVLTGRQVAVPVKVVAVSADGSVTDVTLSVSCSSSDEDVLKVSSSCDSVYVNGKETRGSSNASVNFTYGTLSAQLE 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513   86 VTVWAPRLPLQIEVSDTELSQIKGWRVPIVASK-RPTRESEDEDEeaRRARGCALQYQHATVRVLTQFVAEGAGPWGQPS 164
Cdd:pfam16070  82 LTVWVPRLPLEIEVSDTELSQIKGWRVPVLSNKrRSARDSDDEDD--RKGRGCRLQYQHATVRVLARFVAEDADGSGQLS 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  165 HLLSPDWQVDITHLVADFMKLEEPHVATLQDSRTLVGREVGMTTIQVLSPLSDSILAEKTVTVLDDKVSVTDLAIQLVAG 244
Cdd:pfam16070 160 YLLGRDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTIRVLDDKVSITELGVQLVSG 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  245 LSVTLHPSPENSKVITAVATAEELLRTPKQEAVVSTWLQFSDGSVTPLDIYDTTDFTLTATSLDEAVVSVSQARSPRWPV 324
Cdd:pfam16070 240 LSLSLQPSPGSNRAIVATTSAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYNLSVTSLDEAVVAVAQDAASSWPV 319
                         330       340
                  ....*....|....*....|...
gi 958755513  325 VVAEGEGQGPLVRVDLTIAEACQ 347
Cdd:pfam16070 320 VVAEGEGQGPLLRVELLISEACQ 342
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
460-544 1.32e-49

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


:

Pssm-ID: 318007  Cd Length: 84  Bit Score: 167.50  E-value: 1.32e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  460 TNFPAQVDLPQAGGGlGDSDLVQTPRGLSDLEIGMYALLGVFCLAILVFLINCATFALKYRHKQVPLEGQASMTHSHDWV 539
Cdd:pfam15706   1 TNFPAQTEAPGNNGV-GESDLVQAPRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKSPVEGQGPVPHSHDWV 79

                  ....*
gi 958755513  540 WLGNE 544
Cdd:pfam15706  80 WLGTE 84
 
Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
6-347 0e+00

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


Pssm-ID: 339594  Cd Length: 342  Bit Score: 577.26  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513    6 ILNTAILTGKTVAMPIKVVSVEENGVVTDISEAVECKSTDEDVIKVSDRCDYVFVNGKEMKGKVETVVNFTYQHLSAPLH 85
Cdd:pfam16070   2 LLNTAVLTGRQVAVPVKVVAVSADGSVTDVTLSVSCSSSDEDVLKVSSSCDSVYVNGKETRGSSNASVNFTYGTLSAQLE 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513   86 VTVWAPRLPLQIEVSDTELSQIKGWRVPIVASK-RPTRESEDEDEeaRRARGCALQYQHATVRVLTQFVAEGAGPWGQPS 164
Cdd:pfam16070  82 LTVWVPRLPLEIEVSDTELSQIKGWRVPVLSNKrRSARDSDDEDD--RKGRGCRLQYQHATVRVLARFVAEDADGSGQLS 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  165 HLLSPDWQVDITHLVADFMKLEEPHVATLQDSRTLVGREVGMTTIQVLSPLSDSILAEKTVTVLDDKVSVTDLAIQLVAG 244
Cdd:pfam16070 160 YLLGRDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTIRVLDDKVSITELGVQLVSG 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  245 LSVTLHPSPENSKVITAVATAEELLRTPKQEAVVSTWLQFSDGSVTPLDIYDTTDFTLTATSLDEAVVSVSQARSPRWPV 324
Cdd:pfam16070 240 LSLSLQPSPGSNRAIVATTSAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYNLSVTSLDEAVVAVAQDAASSWPV 319
                         330       340
                  ....*....|....*....|...
gi 958755513  325 VVAEGEGQGPLVRVDLTIAEACQ 347
Cdd:pfam16070 320 VVAEGEGQGPLLRVELLISEACQ 342
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
460-544 1.32e-49

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 318007  Cd Length: 84  Bit Score: 167.50  E-value: 1.32e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  460 TNFPAQVDLPQAGGGlGDSDLVQTPRGLSDLEIGMYALLGVFCLAILVFLINCATFALKYRHKQVPLEGQASMTHSHDWV 539
Cdd:pfam15706   1 TNFPAQTEAPGNNGV-GESDLVQAPRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKSPVEGQGPVPHSHDWV 79

                  ....*
gi 958755513  540 WLGNE 544
Cdd:pfam15706  80 WLGTE 84
 
Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
6-347 0e+00

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


Pssm-ID: 339594  Cd Length: 342  Bit Score: 577.26  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513    6 ILNTAILTGKTVAMPIKVVSVEENGVVTDISEAVECKSTDEDVIKVSDRCDYVFVNGKEMKGKVETVVNFTYQHLSAPLH 85
Cdd:pfam16070   2 LLNTAVLTGRQVAVPVKVVAVSADGSVTDVTLSVSCSSSDEDVLKVSSSCDSVYVNGKETRGSSNASVNFTYGTLSAQLE 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513   86 VTVWAPRLPLQIEVSDTELSQIKGWRVPIVASK-RPTRESEDEDEeaRRARGCALQYQHATVRVLTQFVAEGAGPWGQPS 164
Cdd:pfam16070  82 LTVWVPRLPLEIEVSDTELSQIKGWRVPVLSNKrRSARDSDDEDD--RKGRGCRLQYQHATVRVLARFVAEDADGSGQLS 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  165 HLLSPDWQVDITHLVADFMKLEEPHVATLQDSRTLVGREVGMTTIQVLSPLSDSILAEKTVTVLDDKVSVTDLAIQLVAG 244
Cdd:pfam16070 160 YLLGRDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTIRVLDDKVSITELGVQLVSG 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  245 LSVTLHPSPENSKVITAVATAEELLRTPKQEAVVSTWLQFSDGSVTPLDIYDTTDFTLTATSLDEAVVSVSQARSPRWPV 324
Cdd:pfam16070 240 LSLSLQPSPGSNRAIVATTSAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYNLSVTSLDEAVVAVAQDAASSWPV 319
                         330       340
                  ....*....|....*....|...
gi 958755513  325 VVAEGEGQGPLVRVDLTIAEACQ 347
Cdd:pfam16070 320 VVAEGEGQGPLLRVELLISEACQ 342
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
460-544 1.32e-49

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 318007  Cd Length: 84  Bit Score: 167.50  E-value: 1.32e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 958755513  460 TNFPAQVDLPQAGGGlGDSDLVQTPRGLSDLEIGMYALLGVFCLAILVFLINCATFALKYRHKQVPLEGQASMTHSHDWV 539
Cdd:pfam15706   1 TNFPAQTEAPGNNGV-GESDLVQAPRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKSPVEGQGPVPHSHDWV 79

                  ....*
gi 958755513  540 WLGNE 544
Cdd:pfam15706  80 WLGTE 84
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH