NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|918645194|ref|XP_013361907|]
View 

PREDICTED: transmembrane protein 132A isoform X2 [Chinchilla lanigera]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
447-786 1.12e-143

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


:

Pssm-ID: 339594  Cd Length: 342  Bit Score: 433.20  E-value: 1.12e-143
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   447 ELVNTAPLTGQPGRIPVRLVTVDAGGALAEVTEHIGCKSADTQVLQVSEACDAVFVAGTESRGAKGVRVDFWWRRLHASL 526
Cdd:pfam16070    1 ELLNTAVLTGRQVAVPVKVVAVSADGSVTDVTLSVSCSSSDEDVLKVSSSCDSVYVNGKETRGSSNASVNFTYGTLSAQL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   527 RLTVWAPLLPLRVELSDATLEQVRGWRVPGPPDDGAPEPEPAEEAERRARGCRLLYQRASVHVLAPFVAHAQD--GGLAH 604
Cdd:pfam16070   81 ELTVWVPRLPLEIEVSDTELSQIKGWRVPVLSNKRRSARDSDDEDDRKGRGCRLQYQHATVRVLARFVAEDADgsGQLSY 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   605 LLGPDWLLDVTHLVALHARVQDPRVASLEGGRVLVGREPGVTAIEVRSPLSNAILGEQALAVTDDKVSVLELRVQPVMGI 684
Cdd:pfam16070  161 LLGRDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTIRVLDDKVSITELGVQLVSGL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   685 SLALSRGSAHPGEVTATCWAQSALPTPKQEVALSLWLSFSDHTTAPAELYDRRDLGLSVSAEEPSAVLPATEQGAQLGVV 764
Cdd:pfam16070  241 SLSLQPSPGSNRAIVATTSAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYNLSVTSLDEAVVAVAQDAASSWPVV 320
                          330       340
                   ....*....|....*....|..
gi 918645194   765 VSGVGTEALPLHVALHPPEPCR 786
Cdd:pfam16070  321 VAEGEGQGPLLRVELLISEACQ 342
TMEM132D_N pfam15705
Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal ...
32-154 4.85e-41

Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


:

Pssm-ID: 318006  Cd Length: 130  Bit Score: 147.00  E-value: 4.85e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194    32 AALELLDAPEHFRAQRAGHYPPANSSLGSRSETFLLLQpwPRAQPLFRASYPPFTTQQVVPPQAVEPP-------RRPVP 104
Cdd:pfam15705    1 VSYQLSNADSAFFLKEANQDPMRNSSLQSRSESFFIYQ--AREPPVLNASYGPFSVEQVVPLELLQPSsplgspnKFTFN 78
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|..
gi 918645194   105 WDVRAVSLEVAVAPAEPHARVLFHLKGQDW--PPGPGSLPCARLYATHPAGT 154
Cdd:pfam15705   79 WKVRAFILRSRVYSSRPKVQVLFYIAGRDWddFSPGERLPCVRLFAFRETRE 130
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
865-930 2.76e-28

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


:

Pssm-ID: 318007  Cd Length: 84  Bit Score: 108.56  E-value: 2.76e-28
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 918645194   865 MVPAPQRVTELELGMYALLGIFCLAILIFLVNGVVFVLRYQRKEPPDsAADPASPQPHNWVWLGTD 930
Cdd:pfam15706   20 LVQAPRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKSPV-EGQGPVPHSHDWVWLGTE 84
PHA03247 super family cl33720
large tegument protein UL36; Provisional
52-423 1.55e-03

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 42.62  E-value: 1.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   52 PPANSSLGSRSETFLLLQPWPRAQPLFRASYPPFTTQQVVPPQAVEP-----PRRPV--PWDVRAVSLEVAVAPAEPHAR 124
Cdd:PHA03247 2702 PPPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPatpggPARPArpPTTAGPPAPAPPAAPAAGPPR 2781
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  125 VLFHLKGQDWPPGPGSLPCARLYATHPAGTAHRACRFQPALGACVVeleLPAPWFSRSTPSRAALAYMLEPTAEGpGGCA 204
Cdd:PHA03247 2782 RLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGP---LPPPTSAQPTAPPPPPGPPPPSLPLG-GSVA 2857
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  205 PGGD---QDPAQQALPLGSVELRP----------EDPPQHQEVPLDEAVTLRVPDMAVRPGQPFTATVLLRhnftagvla 271
Cdd:PHA03247 2858 PGGDvrrRPPSRSPAAKPAAPARPpvrrlarpavSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQ--------- 2928
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  272 lrcPHPCMLLSSCGHSRPGP-GGREEQGQPIGRWGAPWQEGSCPGRRAGARgppcvrvrikvkkgLQVTAARPVQPARWT 350
Cdd:PHA03247 2929 ---PQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWLGALVPGRVAVPR--------------FRVPQPAPSREAPAS 2991
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 918645194  351 AKLDRVRGSKHHSTLITCHLAGPAGPDPSAPELSEFLWVDFLVENGTGGGVAVTRPVTWQLEYPGQAPDAEKD 423
Cdd:PHA03247 2992 STPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPPDDTEDSDADSLFDSDSERSDLEALDPLPPEPHD 3064
 
Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
447-786 1.12e-143

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


Pssm-ID: 339594  Cd Length: 342  Bit Score: 433.20  E-value: 1.12e-143
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   447 ELVNTAPLTGQPGRIPVRLVTVDAGGALAEVTEHIGCKSADTQVLQVSEACDAVFVAGTESRGAKGVRVDFWWRRLHASL 526
Cdd:pfam16070    1 ELLNTAVLTGRQVAVPVKVVAVSADGSVTDVTLSVSCSSSDEDVLKVSSSCDSVYVNGKETRGSSNASVNFTYGTLSAQL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   527 RLTVWAPLLPLRVELSDATLEQVRGWRVPGPPDDGAPEPEPAEEAERRARGCRLLYQRASVHVLAPFVAHAQD--GGLAH 604
Cdd:pfam16070   81 ELTVWVPRLPLEIEVSDTELSQIKGWRVPVLSNKRRSARDSDDEDDRKGRGCRLQYQHATVRVLARFVAEDADgsGQLSY 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   605 LLGPDWLLDVTHLVALHARVQDPRVASLEGGRVLVGREPGVTAIEVRSPLSNAILGEQALAVTDDKVSVLELRVQPVMGI 684
Cdd:pfam16070  161 LLGRDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTIRVLDDKVSITELGVQLVSGL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   685 SLALSRGSAHPGEVTATCWAQSALPTPKQEVALSLWLSFSDHTTAPAELYDRRDLGLSVSAEEPSAVLPATEQGAQLGVV 764
Cdd:pfam16070  241 SLSLQPSPGSNRAIVATTSAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYNLSVTSLDEAVVAVAQDAASSWPVV 320
                          330       340
                   ....*....|....*....|..
gi 918645194   765 VSGVGTEALPLHVALHPPEPCR 786
Cdd:pfam16070  321 VAEGEGQGPLLRVELLISEACQ 342
TMEM132D_N pfam15705
Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal ...
32-154 4.85e-41

Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 318006  Cd Length: 130  Bit Score: 147.00  E-value: 4.85e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194    32 AALELLDAPEHFRAQRAGHYPPANSSLGSRSETFLLLQpwPRAQPLFRASYPPFTTQQVVPPQAVEPP-------RRPVP 104
Cdd:pfam15705    1 VSYQLSNADSAFFLKEANQDPMRNSSLQSRSESFFIYQ--AREPPVLNASYGPFSVEQVVPLELLQPSsplgspnKFTFN 78
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|..
gi 918645194   105 WDVRAVSLEVAVAPAEPHARVLFHLKGQDW--PPGPGSLPCARLYATHPAGT 154
Cdd:pfam15705   79 WKVRAFILRSRVYSSRPKVQVLFYIAGRDWddFSPGERLPCVRLFAFRETRE 130
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
865-930 2.76e-28

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 318007  Cd Length: 84  Bit Score: 108.56  E-value: 2.76e-28
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 918645194   865 MVPAPQRVTELELGMYALLGIFCLAILIFLVNGVVFVLRYQRKEPPDsAADPASPQPHNWVWLGTD 930
Cdd:pfam15706   20 LVQAPRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKSPV-EGQGPVPHSHDWVWLGTE 84
PHA03247 PHA03247
large tegument protein UL36; Provisional
52-423 1.55e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 42.62  E-value: 1.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   52 PPANSSLGSRSETFLLLQPWPRAQPLFRASYPPFTTQQVVPPQAVEP-----PRRPV--PWDVRAVSLEVAVAPAEPHAR 124
Cdd:PHA03247 2702 PPPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPatpggPARPArpPTTAGPPAPAPPAAPAAGPPR 2781
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  125 VLFHLKGQDWPPGPGSLPCARLYATHPAGTAHRACRFQPALGACVVeleLPAPWFSRSTPSRAALAYMLEPTAEGpGGCA 204
Cdd:PHA03247 2782 RLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGP---LPPPTSAQPTAPPPPPGPPPPSLPLG-GSVA 2857
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  205 PGGD---QDPAQQALPLGSVELRP----------EDPPQHQEVPLDEAVTLRVPDMAVRPGQPFTATVLLRhnftagvla 271
Cdd:PHA03247 2858 PGGDvrrRPPSRSPAAKPAAPARPpvrrlarpavSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQ--------- 2928
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  272 lrcPHPCMLLSSCGHSRPGP-GGREEQGQPIGRWGAPWQEGSCPGRRAGARgppcvrvrikvkkgLQVTAARPVQPARWT 350
Cdd:PHA03247 2929 ---PQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWLGALVPGRVAVPR--------------FRVPQPAPSREAPAS 2991
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 918645194  351 AKLDRVRGSKHHSTLITCHLAGPAGPDPSAPELSEFLWVDFLVENGTGGGVAVTRPVTWQLEYPGQAPDAEKD 423
Cdd:PHA03247 2992 STPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPPDDTEDSDADSLFDSDSERSDLEALDPLPPEPHD 3064
 
Name Accession Description Interval E-value
TMEM132 pfam16070
Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 ...
447-786 1.12e-143

Transmembrane protein family 132; This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development. TMEM132D may be a marker for oligodendrocyte differentiation.


Pssm-ID: 339594  Cd Length: 342  Bit Score: 433.20  E-value: 1.12e-143
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   447 ELVNTAPLTGQPGRIPVRLVTVDAGGALAEVTEHIGCKSADTQVLQVSEACDAVFVAGTESRGAKGVRVDFWWRRLHASL 526
Cdd:pfam16070    1 ELLNTAVLTGRQVAVPVKVVAVSADGSVTDVTLSVSCSSSDEDVLKVSSSCDSVYVNGKETRGSSNASVNFTYGTLSAQL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   527 RLTVWAPLLPLRVELSDATLEQVRGWRVPGPPDDGAPEPEPAEEAERRARGCRLLYQRASVHVLAPFVAHAQD--GGLAH 604
Cdd:pfam16070   81 ELTVWVPRLPLEIEVSDTELSQIKGWRVPVLSNKRRSARDSDDEDDRKGRGCRLQYQHATVRVLARFVAEDADgsGQLSY 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   605 LLGPDWLLDVTHLVALHARVQDPRVASLEGGRVLVGREPGVTAIEVRSPLSNAILGEQALAVTDDKVSVLELRVQPVMGI 684
Cdd:pfam16070  161 LLGRDWQVDVTDLVADFLRVEDPRVARLQDGRVLQGREPGTTTVQVLSPLSDSVLGEKTIRVLDDKVSITELGVQLVSGL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   685 SLALSRGSAHPGEVTATCWAQSALPTPKQEVALSLWLSFSDHTTAPAELYDRRDLGLSVSAEEPSAVLPATEQGAQLGVV 764
Cdd:pfam16070  241 SLSLQPSPGSNRAIVATTSAQETLTAPKQEALLSAWLQFSDGSVTPLDLYDPSDYNLSVTSLDEAVVAVAQDAASSWPVV 320
                          330       340
                   ....*....|....*....|..
gi 918645194   765 VSGVGTEALPLHVALHPPEPCR 786
Cdd:pfam16070  321 VAEGEGQGPLLRVELLISEACQ 342
TMEM132D_N pfam15705
Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal ...
32-154 4.85e-41

Mature oligodendrocyte transmembrane protein, TMEM132D, N-term; TMEM132D_N is the N-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 318006  Cd Length: 130  Bit Score: 147.00  E-value: 4.85e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194    32 AALELLDAPEHFRAQRAGHYPPANSSLGSRSETFLLLQpwPRAQPLFRASYPPFTTQQVVPPQAVEPP-------RRPVP 104
Cdd:pfam15705    1 VSYQLSNADSAFFLKEANQDPMRNSSLQSRSESFFIYQ--AREPPVLNASYGPFSVEQVVPLELLQPSsplgspnKFTFN 78
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|..
gi 918645194   105 WDVRAVSLEVAVAPAEPHARVLFHLKGQDW--PPGPGSLPCARLYATHPAGT 154
Cdd:pfam15705   79 WKVRAFILRSRVYSSRPKVQVLFYIAGRDWddFSPGERLPCVRLFAFRETRE 130
TMEM132D_C pfam15706
Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal ...
865-930 2.76e-28

Mature oligodendrocyte transmembrane protein, TMEM132D, C-term; TMEM132D_C is the C-terminal family of chordate proteins implicated in panic disorder. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation. Additionally, as it may be most strongly expressed in neurons and it colocalizes with actin filaments TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour.


Pssm-ID: 318007  Cd Length: 84  Bit Score: 108.56  E-value: 2.76e-28
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 918645194   865 MVPAPQRVTELELGMYALLGIFCLAILIFLVNGVVFVLRYQRKEPPDsAADPASPQPHNWVWLGTD 930
Cdd:pfam15706   20 LVQAPRGLTDLEIGMYALLGVFCLAILVFLINCVVFALKYRRKKSPV-EGQGPVPHSHDWVWLGTE 84
PHA03247 PHA03247
large tegument protein UL36; Provisional
52-423 1.55e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 42.62  E-value: 1.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194   52 PPANSSLGSRSETFLLLQPWPRAQPLFRASYPPFTTQQVVPPQAVEP-----PRRPV--PWDVRAVSLEVAVAPAEPHAR 124
Cdd:PHA03247 2702 PPPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPatpggPARPArpPTTAGPPAPAPPAAPAAGPPR 2781
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  125 VLFHLKGQDWPPGPGSLPCARLYATHPAGTAHRACRFQPALGACVVeleLPAPWFSRSTPSRAALAYMLEPTAEGpGGCA 204
Cdd:PHA03247 2782 RLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGP---LPPPTSAQPTAPPPPPGPPPPSLPLG-GSVA 2857
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  205 PGGD---QDPAQQALPLGSVELRP----------EDPPQHQEVPLDEAVTLRVPDMAVRPGQPFTATVLLRhnftagvla 271
Cdd:PHA03247 2858 PGGDvrrRPPSRSPAAKPAAPARPpvrrlarpavSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQ--------- 2928
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 918645194  272 lrcPHPCMLLSSCGHSRPGP-GGREEQGQPIGRWGAPWQEGSCPGRRAGARgppcvrvrikvkkgLQVTAARPVQPARWT 350
Cdd:PHA03247 2929 ---PQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWLGALVPGRVAVPR--------------FRVPQPAPSREAPAS 2991
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 918645194  351 AKLDRVRGSKHHSTLITCHLAGPAGPDPSAPELSEFLWVDFLVENGTGGGVAVTRPVTWQLEYPGQAPDAEKD 423
Cdd:PHA03247 2992 STPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWPPDDTEDSDADSLFDSDSERSDLEALDPLPPEPHD 3064
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH