NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1383214406|ref|WP_108382444|]
View 

twin-arginine translocation signal domain-containing protein [Haloarculaceae archaeon HArcel1]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Glyco_hydro_1 super family cl23725
Glycosyl hydrolase family 1;
171-373 2.19e-25

Glycosyl hydrolase family 1;


The actual alignment was detected with superfamily member pfam00150:

Pssm-ID: 355022  Cd Length: 264  Bit Score: 106.28  E-value: 2.19e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 171 VVQACIDNDVYCIVDYHRHWGdgelaWAEGDEYGNpkgpnpgLDEEVR---TFWDTVAPHFADVPNVLFELYNEPTkpgw 247
Cdd:pfam00150  64 VVDYAIDNGMYVIIDWHHDGL-----WQPGDPNGN-------IDTAKEffkKIWTQIATRYGYNDHVIFELMNEPH---- 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 248 GPEDVIWNGWRSVAQPWVDIIREHAPRNMILIGNPRWS--RMVWGIKYGEfDGDNLGYTYHAYPG------HAVTDFDDD 319
Cdd:pfam00150 128 GNDSATWDDVKDYAQEAIDAIRATGPNNLIIVGGNNWSgnPDGAALNDPN-DDDNLIYSVHFYAPsdfsgtWFGCEDPTN 206
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 320 TGNAWEQA---------PLFVTEWG-------YSEGRCKWIcgndqrfgtpfkEWASERPIHWTAWCFDP 373
Cdd:pfam00150 207 LDQRFRAAanwaldngiPVFIGEFGggnadgpCRDEAEKWL------------DYLKENGISWTGWSNNN 264
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
544-619 2.07e-10

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


:

Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 57.62  E-value: 2.07e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406  544 PDVPSGLEIVDRTHESITVSWSGVTDTGPSG-VHHYTVALDGS----VRTRVAAGSTETTLEDLAPETEYEITVTAVDTA 618
Cdd:smart00060   1 PSPPSNLRVTDVTSTSVTLSWEPPPDDGITGyIVGYRVEYREEgsewKEVNVTPSSTSYTLTGLKPGTEYEFRVRAVNGA 80

                   .
gi 1383214406  619 G 619
Cdd:smart00060  81 G 81
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
794-883 2.17e-09

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


:

Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 55.20  E-value: 2.17e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 794 PSTPADLAVDGTTDESITVSWTESTDAGGSgVANYALWASTHGPVETVAETTVDGKTTQATLSGLiKADRTYQIHVQAID 873
Cdd:cd00063     1 PSPPTNLRVTDVTSTSVTLSWTPPEDDGGP-ITGYVVEYREKGSGDWKEVEVTPGSETSYTLTGL-KPGTEYEFRVRAVN 78
                          90
                  ....*....|
gi 1383214406 874 GAGnKSAPAT 883
Cdd:cd00063    79 GGG-ESPPSE 87
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
459-535 1.62e-07

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


:

Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 49.80  E-value: 1.62e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 459 VDQTSVAIGWDQPANPGdSPFDGYVVYV------DGRQRTTLGPDTTTYTVEELLSDTRYQISVTGIDVAGnEGRPAT-V 531
Cdd:cd00063    12 VTSTSVTLSWTPPEDDG-GPITGYVVEYrekgsgDWKEVEVTPGSETSYTLTGLKPGTEYEFRVRAVNGGG-ESPPSEsV 89

                  ....
gi 1383214406 532 TVTT 535
Cdd:cd00063    90 TVTT 93
Dockerin_like super family cl21530
Dockerin repeat domains and domains resembling dockerin repeats; Dockerins are modules in the ...
920-968 3.39e-05

Dockerin repeat domains and domains resembling dockerin repeats; Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.


The actual alignment was detected with superfamily member cd14254:

Pssm-ID: 277547  Cd Length: 54  Bit Score: 41.81  E-value: 3.39e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 1383214406 920 DLSGDGRINFPDVNTLFQNTDSDRAARNSEFYDFTGDGVVDMQDVLALF 968
Cdd:cd14254     2 DVNGDGVVDIADLALVSQHFGKTSDAGYVPAADLNGDGVIDAADLALLA 50
 
Name Accession Description Interval E-value
Cellulase pfam00150
Cellulase (glycosyl hydrolase family 5);
171-373 2.19e-25

Cellulase (glycosyl hydrolase family 5);


Pssm-ID: 333879  Cd Length: 264  Bit Score: 106.28  E-value: 2.19e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 171 VVQACIDNDVYCIVDYHRHWGdgelaWAEGDEYGNpkgpnpgLDEEVR---TFWDTVAPHFADVPNVLFELYNEPTkpgw 247
Cdd:pfam00150  64 VVDYAIDNGMYVIIDWHHDGL-----WQPGDPNGN-------IDTAKEffkKIWTQIATRYGYNDHVIFELMNEPH---- 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 248 GPEDVIWNGWRSVAQPWVDIIREHAPRNMILIGNPRWS--RMVWGIKYGEfDGDNLGYTYHAYPG------HAVTDFDDD 319
Cdd:pfam00150 128 GNDSATWDDVKDYAQEAIDAIRATGPNNLIIVGGNNWSgnPDGAALNDPN-DDDNLIYSVHFYAPsdfsgtWFGCEDPTN 206
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 320 TGNAWEQA---------PLFVTEWG-------YSEGRCKWIcgndqrfgtpfkEWASERPIHWTAWCFDP 373
Cdd:pfam00150 207 LDQRFRAAanwaldngiPVFIGEFGggnadgpCRDEAEKWL------------DYLKENGISWTGWSNNN 264
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
544-619 2.07e-10

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 57.62  E-value: 2.07e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406  544 PDVPSGLEIVDRTHESITVSWSGVTDTGPSG-VHHYTVALDGS----VRTRVAAGSTETTLEDLAPETEYEITVTAVDTA 618
Cdd:smart00060   1 PSPPSNLRVTDVTSTSVTLSWEPPPDDGITGyIVGYRVEYREEgsewKEVNVTPSSTSYTLTGLKPGTEYEFRVRAVNGA 80

                   .
gi 1383214406  619 G 619
Cdd:smart00060  81 G 81
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
794-883 2.17e-09

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 55.20  E-value: 2.17e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 794 PSTPADLAVDGTTDESITVSWTESTDAGGSgVANYALWASTHGPVETVAETTVDGKTTQATLSGLiKADRTYQIHVQAID 873
Cdd:cd00063     1 PSPPTNLRVTDVTSTSVTLSWTPPEDDGGP-ITGYVVEYREKGSGDWKEVEVTPGSETSYTLTGL-KPGTEYEFRVRAVN 78
                          90
                  ....*....|
gi 1383214406 874 GAGnKSAPAT 883
Cdd:cd00063    79 GGG-ESPPSE 87
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
544-619 3.57e-09

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 54.42  E-value: 3.57e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 544 PDVPSGLEIVDRTHESITVSWSGVTDTGpSGVHHYTV----ALDGSVRT--RVAAGSTETTLEDLAPETEYEITVTAVDT 617
Cdd:cd00063     1 PSPPTNLRVTDVTSTSVTLSWTPPEDDG-GPITGYVVeyreKGSGDWKEveVTPGSETSYTLTGLKPGTEYEFRVRAVNG 79

                  ..
gi 1383214406 618 AG 619
Cdd:cd00063    80 GG 81
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
794-876 8.89e-09

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 53.00  E-value: 8.89e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406  794 PSTPADLAVDGTTDESITVSWTESTDAGGSG-VANYalWASTHGPVETVAETTVDGKTTQATLSGLiKADRTYQIHVQAI 872
Cdd:smart00060   1 PSPPSNLRVTDVTSTSVTLSWEPPPDDGITGyIVGY--RVEYREEGSEWKEVNVTPSSTSYTLTGL-KPGTEYEFRVRAV 77

                   ....
gi 1383214406  873 DGAG 876
Cdd:smart00060  78 NGAG 81
fn3 pfam00041
Fibronectin type III domain;
795-877 3.03e-08

Fibronectin type III domain;


Pssm-ID: 333790  Cd Length: 84  Bit Score: 51.64  E-value: 3.03e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 795 STPADLAVDGTTDESITVSWTESTDAGGSgVANYALWASTHGPVETVAETTVDGKTTQATLSGLiKADRTYQIHVQAIDG 874
Cdd:pfam00041   1 SAPTNLSVTDVTSTSLTVSWTPPPDGNGP-ITGYRVEYRPVNGGEPWNEITVPGTTTSVTLTGL-RPGTEYEVRVQAVNG 78

                  ...
gi 1383214406 875 AGN 877
Cdd:pfam00041  79 GGE 81
fn3 pfam00041
Fibronectin type III domain;
545-620 3.12e-08

Fibronectin type III domain;


Pssm-ID: 333790  Cd Length: 84  Bit Score: 51.64  E-value: 3.12e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 545 DVPSGLEIVDRTHESITVSWSGVTDtGPSGVHHYTVAL------DGSVRTRVAAGSTETTLEDLAPETEYEITVTAVDTA 618
Cdd:pfam00041   1 SAPTNLSVTDVTSTSLTVSWTPPPD-GNGPITGYRVEYrpvnggEPWNEITVPGTTTSVTLTGLRPGTEYEVRVQAVNGG 79

                  ..
gi 1383214406 619 GN 620
Cdd:pfam00041  80 GE 81
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
459-535 1.62e-07

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 49.80  E-value: 1.62e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 459 VDQTSVAIGWDQPANPGdSPFDGYVVYV------DGRQRTTLGPDTTTYTVEELLSDTRYQISVTGIDVAGnEGRPAT-V 531
Cdd:cd00063    12 VTSTSVTLSWTPPEDDG-GPITGYVVEYrekgsgDWKEVEVTPGSETSYTLTGLKPGTEYEFRVRAVNGGG-ESPPSEsV 89

                  ....
gi 1383214406 532 TVTT 535
Cdd:cd00063    90 TVTT 93
fn3 pfam00041
Fibronectin type III domain;
459-524 4.52e-06

Fibronectin type III domain;


Pssm-ID: 333790  Cd Length: 84  Bit Score: 45.47  E-value: 4.52e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1383214406 459 VDQTSVAIGWdQPANPGDSPFDGYVVYV------DGRQRTTLGPDTTTYTVEELLSDTRYQISVTGIDVAGN 524
Cdd:pfam00041  11 VTSTSLTVSW-TPPPDGNGPITGYRVEYrpvnggEPWNEITVPGTTTSVTLTGLRPGTEYEVRVQAVNGGGE 81
Dockerin_II cd14254
Type II dockerin repeat domain; Bacterial cohesin domains bind to a complementary protein ...
920-968 3.39e-05

Type II dockerin repeat domain; Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.


Pssm-ID: 271213  Cd Length: 54  Bit Score: 41.81  E-value: 3.39e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 1383214406 920 DLSGDGRINFPDVNTLFQNTDSDRAARNSEFYDFTGDGVVDMQDVLALF 968
Cdd:cd14254     2 DVNGDGVVDIADLALVSQHFGKTSDAGYVPAADLNGDGVIDAADLALLA 50
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
459-523 8.24e-05

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 41.83  E-value: 8.24e-05
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406  459 VDQTSVAIGWDQPANPG-DSPFDGYVVYVDGR----QRTTLGPDTTTYTVEELLSDTRYQISVTGIDVAG 523
Cdd:smart00060  12 VTSTSVTLSWEPPPDDGiTGYIVGYRVEYREEgsewKEVNVTPSSTSYTLTGLKPGTEYEFRVRAVNGAG 81
 
Name Accession Description Interval E-value
Cellulase pfam00150
Cellulase (glycosyl hydrolase family 5);
171-373 2.19e-25

Cellulase (glycosyl hydrolase family 5);


Pssm-ID: 333879  Cd Length: 264  Bit Score: 106.28  E-value: 2.19e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 171 VVQACIDNDVYCIVDYHRHWGdgelaWAEGDEYGNpkgpnpgLDEEVR---TFWDTVAPHFADVPNVLFELYNEPTkpgw 247
Cdd:pfam00150  64 VVDYAIDNGMYVIIDWHHDGL-----WQPGDPNGN-------IDTAKEffkKIWTQIATRYGYNDHVIFELMNEPH---- 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 248 GPEDVIWNGWRSVAQPWVDIIREHAPRNMILIGNPRWS--RMVWGIKYGEfDGDNLGYTYHAYPG------HAVTDFDDD 319
Cdd:pfam00150 128 GNDSATWDDVKDYAQEAIDAIRATGPNNLIIVGGNNWSgnPDGAALNDPN-DDDNLIYSVHFYAPsdfsgtWFGCEDPTN 206
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 320 TGNAWEQA---------PLFVTEWG-------YSEGRCKWIcgndqrfgtpfkEWASERPIHWTAWCFDP 373
Cdd:pfam00150 207 LDQRFRAAanwaldngiPVFIGEFGggnadgpCRDEAEKWL------------DYLKENGISWTGWSNNN 264
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
544-619 2.07e-10

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 57.62  E-value: 2.07e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406  544 PDVPSGLEIVDRTHESITVSWSGVTDTGPSG-VHHYTVALDGS----VRTRVAAGSTETTLEDLAPETEYEITVTAVDTA 618
Cdd:smart00060   1 PSPPSNLRVTDVTSTSVTLSWEPPPDDGITGyIVGYRVEYREEgsewKEVNVTPSSTSYTLTGLKPGTEYEFRVRAVNGA 80

                   .
gi 1383214406  619 G 619
Cdd:smart00060  81 G 81
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
794-883 2.17e-09

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 55.20  E-value: 2.17e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 794 PSTPADLAVDGTTDESITVSWTESTDAGGSgVANYALWASTHGPVETVAETTVDGKTTQATLSGLiKADRTYQIHVQAID 873
Cdd:cd00063     1 PSPPTNLRVTDVTSTSVTLSWTPPEDDGGP-ITGYVVEYREKGSGDWKEVEVTPGSETSYTLTGL-KPGTEYEFRVRAVN 78
                          90
                  ....*....|
gi 1383214406 874 GAGnKSAPAT 883
Cdd:cd00063    79 GGG-ESPPSE 87
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
544-619 3.57e-09

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 54.42  E-value: 3.57e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 544 PDVPSGLEIVDRTHESITVSWSGVTDTGpSGVHHYTV----ALDGSVRT--RVAAGSTETTLEDLAPETEYEITVTAVDT 617
Cdd:cd00063     1 PSPPTNLRVTDVTSTSVTLSWTPPEDDG-GPITGYVVeyreKGSGDWKEveVTPGSETSYTLTGLKPGTEYEFRVRAVNG 79

                  ..
gi 1383214406 618 AG 619
Cdd:cd00063    80 GG 81
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
794-876 8.89e-09

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 53.00  E-value: 8.89e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406  794 PSTPADLAVDGTTDESITVSWTESTDAGGSG-VANYalWASTHGPVETVAETTVDGKTTQATLSGLiKADRTYQIHVQAI 872
Cdd:smart00060   1 PSPPSNLRVTDVTSTSVTLSWEPPPDDGITGyIVGY--RVEYREEGSEWKEVNVTPSSTSYTLTGL-KPGTEYEFRVRAV 77

                   ....
gi 1383214406  873 DGAG 876
Cdd:smart00060  78 NGAG 81
fn3 pfam00041
Fibronectin type III domain;
795-877 3.03e-08

Fibronectin type III domain;


Pssm-ID: 333790  Cd Length: 84  Bit Score: 51.64  E-value: 3.03e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 795 STPADLAVDGTTDESITVSWTESTDAGGSgVANYALWASTHGPVETVAETTVDGKTTQATLSGLiKADRTYQIHVQAIDG 874
Cdd:pfam00041   1 SAPTNLSVTDVTSTSLTVSWTPPPDGNGP-ITGYRVEYRPVNGGEPWNEITVPGTTTSVTLTGL-RPGTEYEVRVQAVNG 78

                  ...
gi 1383214406 875 AGN 877
Cdd:pfam00041  79 GGE 81
fn3 pfam00041
Fibronectin type III domain;
545-620 3.12e-08

Fibronectin type III domain;


Pssm-ID: 333790  Cd Length: 84  Bit Score: 51.64  E-value: 3.12e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 545 DVPSGLEIVDRTHESITVSWSGVTDtGPSGVHHYTVAL------DGSVRTRVAAGSTETTLEDLAPETEYEITVTAVDTA 618
Cdd:pfam00041   1 SAPTNLSVTDVTSTSLTVSWTPPPD-GNGPITGYRVEYrpvnggEPWNEITVPGTTTSVTLTGLRPGTEYEVRVQAVNGG 79

                  ..
gi 1383214406 619 GN 620
Cdd:pfam00041  80 GE 81
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
459-535 1.62e-07

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 49.80  E-value: 1.62e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 459 VDQTSVAIGWDQPANPGdSPFDGYVVYV------DGRQRTTLGPDTTTYTVEELLSDTRYQISVTGIDVAGnEGRPAT-V 531
Cdd:cd00063    12 VTSTSVTLSWTPPEDDG-GPITGYVVEYrekgsgDWKEVEVTPGSETSYTLTGLKPGTEYEFRVRAVNGGG-ESPPSEsV 89

                  ....
gi 1383214406 532 TVTT 535
Cdd:cd00063    90 TVTT 93
fn3 pfam00041
Fibronectin type III domain;
459-524 4.52e-06

Fibronectin type III domain;


Pssm-ID: 333790  Cd Length: 84  Bit Score: 45.47  E-value: 4.52e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1383214406 459 VDQTSVAIGWdQPANPGDSPFDGYVVYV------DGRQRTTLGPDTTTYTVEELLSDTRYQISVTGIDVAGN 524
Cdd:pfam00041  11 VTSTSLTVSW-TPPPDGNGPITGYRVEYrpvnggEPWNEITVPGTTTSVTLTGLRPGTEYEVRVQAVNGGGE 81
Dockerin_II cd14254
Type II dockerin repeat domain; Bacterial cohesin domains bind to a complementary protein ...
920-968 3.39e-05

Type II dockerin repeat domain; Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.


Pssm-ID: 271213  Cd Length: 54  Bit Score: 41.81  E-value: 3.39e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 1383214406 920 DLSGDGRINFPDVNTLFQNTDSDRAARNSEFYDFTGDGVVDMQDVLALF 968
Cdd:cd14254     2 DVNGDGVVDIADLALVSQHFGKTSDAGYVPAADLNGDGVIDAADLALLA 50
DUF4998 pfam16389
Domain of unknown function; This family around 200 residues locates in the N-terminal of some ...
482-617 6.98e-05

Domain of unknown function; This family around 200 residues locates in the N-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.


Pssm-ID: 318580  Cd Length: 198  Bit Score: 44.57  E-value: 6.98e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406 482 YVVYVDGRQRTTLGP-------DTTTYTVEELLSDTrYQISVTGIDVAGNEGRPATVTVTT--DAYDDSTppdVPSGLEI 552
Cdd:pfam16389  50 ARIFWNNGKDSLEVPvartagvDTISVIIDNLPEGS-YTFSIVTYDDEGNKSLPSEVTGTVygDRYQSSL---TNRSIKS 125
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1383214406 553 VDRTHESITVSWSGVTDTGPSGVH-HYTVAlDGSVRT-RVAAGSTETTLEDLAPETEYEI------TVTAVDT 617
Cdd:pfam16389 126 AEMDGNNLTINWSPALAETVVYTEiTYTNN-DGKVKTvTIPPGETETVLEDYKPGTSFKYrtvylpEETAIDT 197
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
459-523 8.24e-05

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 41.83  E-value: 8.24e-05
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1383214406  459 VDQTSVAIGWDQPANPG-DSPFDGYVVYVDGR----QRTTLGPDTTTYTVEELLSDTRYQISVTGIDVAG 523
Cdd:smart00060  12 VTSTSVTLSWEPPPDDGiTGYIVGYRVEYREEgsewKEVNVTPSSTSYTLTGLKPGTEYEFRVRAVNGAG 81
Pur_ac_phosph_N pfam16656
Purple acid Phosphatase, N-terminal domain; This domain is found at the N-terminus of Purple ...
800-871 8.02e-03

Purple acid Phosphatase, N-terminal domain; This domain is found at the N-terminus of Purple acid phosphatase proteins.


Pssm-ID: 318794  Cd Length: 92  Bit Score: 36.61  E-value: 8.02e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1383214406 800 LAVDGTTDESITVSWTESTDAGGS----GVANYALWASTHGPVETV-AETTVDGKTTQATLSGLiKADRTYQIHVQA 871
Cdd:pfam16656   4 LSLTGDPSTSMTVTWVTPADVTSPvvqyGTSPDALTSTANGTSSTYtTGNGTSGYIHRATLTGL-EPGTTYYYRVGD 79
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH