NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1180814620|ref|WP_084288278|]
View 

hypothetical protein [Desulfovermiculus halophilus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
400-528 1.51e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


:

Pssm-ID: 334238  Cd Length: 127  Bit Score: 90.59  E-value: 1.51e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 400 SVDSQEVNGEDGAARNAVDGNEDTFWHTewdySEPDYPHQIVIDLGSAQEVVGLQYLPRQDGsENGMIKDYEVYVSQDGY 479
Cdd:pfam00754   1 QITASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGE 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1180814620 480 TWGSPVS---SGSWQAGEDEKQITFSGKTGQYVKLVGLSEVNGNPWASAAEI 528
Cdd:pfam00754  76 NWTTVKDdkiPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
231-356 4.30e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


:

Pssm-ID: 334238  Cd Length: 127  Bit Score: 89.05  E-value: 4.30e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 231 SEETAREDGAVANAIDGDEYTFWHTewsdAEPDYPHEVVIDLGGTYDVSGLRYLPRQDGsENGMIADYEIFVTSDRSNW- 309
Cdd:pfam00754   4 ASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGENWt 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 1180814620 310 --GDPVQTGTWTAAAEQSQTTFENKVGRYVKLVGLSEVNGNPWASAAEI 356
Cdd:pfam00754  79 tvKDDKIPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
573-701 7.76e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


:

Pssm-ID: 334238  Cd Length: 127  Bit Score: 88.66  E-value: 7.76e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 573 SADSEETYGEDGAARNAADGNEDTFWHTewdyAEPDYPHEIILDLGSSREVVGLHYLPRQDGyENGMIKDYEIYVSQDGY 652
Cdd:pfam00754   1 QITASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGE 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1180814620 653 TWGSPVS---SGSWQAGENEKQVTFSGKTGQYVKLVGLSEVNGNPWASAAEV 701
Cdd:pfam00754  76 NWTTVKDdkiPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
44-122 3.85e-07

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


:

Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 47.99  E-value: 3.85e-07
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1180814620   44 PVLFLASSGSHAASVQLSWDKVNDSRVEGYNIYYGPSGTSYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADG 122
Cdd:smart00060   3 PPSNLRVTDVTSTSVTLSWEPPPDDGITGYIVGYRVEYREEGSEWKEVNVTPSSTSYTLTGLKPGTEYEFRVRAVNGAG 81
MSCRAMM_SdrC super family cl37921
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
89-215 6.29e-05

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


The actual alignment was detected with superfamily member NF000535:

Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 46.36  E-value: 6.29e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  89 DQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGN-ESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGTDPDTA 167
Cdd:NF000535  697 DVTITDHDDFTLDNGYYEEETSDSDSDSDSDSDSDsDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 776
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 1180814620 168 DTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  777 DSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 825
 
Name Accession Description Interval E-value
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
400-528 1.51e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


Pssm-ID: 334238  Cd Length: 127  Bit Score: 90.59  E-value: 1.51e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 400 SVDSQEVNGEDGAARNAVDGNEDTFWHTewdySEPDYPHQIVIDLGSAQEVVGLQYLPRQDGsENGMIKDYEVYVSQDGY 479
Cdd:pfam00754   1 QITASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGE 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1180814620 480 TWGSPVS---SGSWQAGEDEKQITFSGKTGQYVKLVGLSEVNGNPWASAAEI 528
Cdd:pfam00754  76 NWTTVKDdkiPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
231-356 4.30e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


Pssm-ID: 334238  Cd Length: 127  Bit Score: 89.05  E-value: 4.30e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 231 SEETAREDGAVANAIDGDEYTFWHTewsdAEPDYPHEVVIDLGGTYDVSGLRYLPRQDGsENGMIADYEIFVTSDRSNW- 309
Cdd:pfam00754   4 ASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGENWt 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 1180814620 310 --GDPVQTGTWTAAAEQSQTTFENKVGRYVKLVGLSEVNGNPWASAAEI 356
Cdd:pfam00754  79 tvKDDKIPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
573-701 7.76e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


Pssm-ID: 334238  Cd Length: 127  Bit Score: 88.66  E-value: 7.76e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 573 SADSEETYGEDGAARNAADGNEDTFWHTewdyAEPDYPHEIILDLGSSREVVGLHYLPRQDGyENGMIKDYEIYVSQDGY 652
Cdd:pfam00754   1 QITASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGE 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1180814620 653 TWGSPVS---SGSWQAGENEKQVTFSGKTGQYVKLVGLSEVNGNPWASAAEV 701
Cdd:pfam00754  76 NWTTVKDdkiPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
FA58C cd00057
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
572-658 5.22e-13

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 238014  Cd Length: 143  Bit Score: 66.61  E-value: 5.22e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 572 LSADSEETYGedGAARNAaDGNEDTFWHTEWDyaepDYPHEIILDLGSSREVVGLHYLPRQDGYENGMIKDYEIYVSQDG 651
Cdd:cd00057    14 ITASSSYSSG--WEASRA-RLNSDNAWTPAVN----DPPQWLQVDLGKTRRVTGIQTQGRKGGGSSEWVTSYKVQYSLDG 86

                  ....*..
gi 1180814620 652 YTWGSPV 658
Cdd:cd00057    87 ETWTTYK 93
FA58C cd00057
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
399-485 5.64e-13

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 238014  Cd Length: 143  Bit Score: 66.61  E-value: 5.64e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 399 LSVDSQEvnGEDGAARNAvDGNEDTFWHTEWDysepDYPHQIVIDLGSAQEVVGLQYLPRQDGSENGMIKDYEVYVSQDG 478
Cdd:cd00057    14 ITASSSY--SSGWEASRA-RLNSDNAWTPAVN----DPPQWLQVDLGKTRRVTGIQTQGRKGGGSSEWVTSYKVQYSLDG 86

                  ....*..
gi 1180814620 479 YTWGSPV 485
Cdd:cd00057    87 ETWTTYK 93
FA58C cd00057
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
228-347 1.30e-11

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 238014  Cd Length: 143  Bit Score: 62.75  E-value: 1.30e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 228 STDSEETAredgavANAIDGDEYTFWHTEWSDaepdYPHEVVIDLGGTYDVSGLRYLPRQDGSENGMIADYEIFVTSDRS 307
Cdd:cd00057    18 SSYSSGWE------ASRARLNSDNAWTPAVND----PPQWLQVDLGKTRRVTGIQTQGRKGGGSSEWVTSYKVQYSLDGE 87
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 1180814620 308 NWGDPVQ-----TGTWTAAAEQSQTTFENK--VGRYVKLVGLSEVNG 347
Cdd:cd00057    88 TWTTYKDkgeekVFTGNSDGSTPVTNDFPPpiVARYIRILPTTWNGN 134
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
44-122 3.85e-07

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 47.99  E-value: 3.85e-07
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1180814620   44 PVLFLASSGSHAASVQLSWDKVNDSRVEGYNIYYGPSGTSYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADG 122
Cdd:smart00060   3 PPSNLRVTDVTSTSVTLSWEPPPDDGITGYIVGYRVEYREEGSEWKEVNVTPSSTSYTLTGLKPGTEYEFRVRAVNGAG 81
FA58C smart00231
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
237-360 1.08e-06

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 214572  Cd Length: 139  Bit Score: 48.27  E-value: 1.08e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  237 EDGAVANAIDGDEYTFWHTewsdAEPDYPHEVVIDLGGTYDVSGLRYlPRQDGSENGMIadYEIFVTSDRSNWGDPVQTG 316
Cdd:smart00231  20 YWAAKIARLNGGSDGGWCP----AKNDLPPWIQVDLGRLRTVTGVIT-GRRHGNGDWVT--YKLEYSDDGVNWTTYKDGN 92
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|
gi 1180814620  317 --TWTAAAEQSQTTFEN----KVGRYVKLVGLSEVNGNpwasAAEITLLG 360
Cdd:smart00231  93 skVFPGNSDAGTVVLNDfpppIVARYVRILPTGWNGNI----ILRVELLG 138
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
57-131 1.63e-06

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 46.72  E-value: 1.63e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1180814620  57 SVQLSWDKVND--SRVEGYNIYYGPSGTSYTVQEdqTVTDRDQTTCTISGLEEGQIYGFTATSFDADGnESDFSSHV 131
Cdd:cd00063    16 SVTLSWTPPEDdgGPITGYVVEYREKGSGDWKEV--EVTPGSETSYTLTGLKPGTEYEFRVRAVNGGG-ESPPSESV 89
FA58C smart00231
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
406-489 3.39e-05

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 214572  Cd Length: 139  Bit Score: 44.04  E-value: 3.39e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  406 VNGEDGAARNAVDGNEDTFWHTEwdysEPDYPHQIVIDLGSAQEVVGLQYlPRQDGSENGMIkdYEVYVSQDGYTWGSPV 485
Cdd:smart00231  17 SSSYWAAKIARLNGGSDGGWCPA----KNDLPPWIQVDLGRLRTVTGVIT-GRRHGNGDWVT--YKLEYSDDGVNWTTYK 89

                   ....
gi 1180814620  486 SSGS 489
Cdd:smart00231  90 DGNS 93
FA58C smart00231
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
580-706 4.40e-05

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 214572  Cd Length: 139  Bit Score: 43.65  E-value: 4.40e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  580 YGEDGAARNAADGNEDTFWHTewdyAEPDYPHEIILDLGSSREVVGLhYLPRQDGYENGMIkdYEIYVSQDGYTWGSPVS 659
Cdd:smart00231  18 SSYWAAKIARLNGGSDGGWCP----AKNDLPPWIQVDLGRLRTVTGV-ITGRRHGNGDWVT--YKLEYSDDGVNWTTYKD 90
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*..
gi 1180814620  660 SGSwqagenekqVTFSGKTGqyvklvglsevNGNPWASAAEVGIVAR 706
Cdd:smart00231  91 GNS---------KVFPGNSD-----------AGTVVLNDFPPPIVAR 117
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
89-215 6.29e-05

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 46.36  E-value: 6.29e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  89 DQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGN-ESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGTDPDTA 167
Cdd:NF000535  697 DVTITDHDDFTLDNGYYEEETSDSDSDSDSDSDSDsDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 776
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 1180814620 168 DTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  777 DSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 825
DUF4998 pfam16389
Domain of unknown function; This family around 200 residues locates in the N-terminal of some ...
58-132 2.63e-04

Domain of unknown function; This family around 200 residues locates in the N-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.


Pssm-ID: 318580  Cd Length: 198  Bit Score: 42.65  E-value: 2.63e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1180814620  58 VQLSWDKVNDSRVEGYNIYYGPSGTSYTVQEDQTvTDRDQTTCTISGLEEGQiYGFTATSFDADGNES---DFSSHVY 132
Cdd:pfam16389  35 VKLTWLLVSDPKITKARIFWNNGKDSLEVPVART-AGVDTISVIIDNLPEGS-YTFSIVTYDDEGNKSlpsEVTGTVY 110
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
82-215 2.70e-04

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 44.05  E-value: 2.70e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  82 TSYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGNESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHG 161
Cdd:NF000535  717 TSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 796
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 1180814620 162 TDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 851
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
87-215 1.16e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 42.12  E-value: 1.16e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  87 QEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGNESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGTDPDT 166
Cdd:NF000535  714 EEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 793
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 1180814620 167 ADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  794 SDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 843
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
76-215 1.58e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 41.74  E-value: 1.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  76 YYGPSGTSYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGNESDFSSHVYYNVPESADDQDSLDSDGDGLTDS 155
Cdd:NF000535  713 YEEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 792
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1180814620 156 EEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  793 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 853
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-244 2.35e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 40.97  E-value: 2.35e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  823 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 901
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 1180814620 216 IELVPQAQMRILSTDSE---------ETAREDGAVANA 244
Cdd:NF000535  902 SDAGKHTPAKPMSTVKDhhnkakalpETGSENNGSNNA 939
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
83-215 4.58e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 40.20  E-value: 4.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  83 SYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGNESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGT 162
Cdd:NF000535  730 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 809
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1180814620 163 DPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  810 SDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 863
MSCRAMM_SdrD NF012181
MSCRAMM family adhesin SdrD; Features of this protein family include a YSIRK-type signal ...
89-215 5.27e-03

MSCRAMM family adhesin SdrD; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333730 [Multi-domain]  Cd Length: 1379  Bit Score: 40.18  E-value: 5.27e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620   89 DQTVTDRDQTTCTISGLEEGQIYGFTATSFDAD-----GNESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGTD 163
Cdd:NF012181  1103 DVTITDHDDFTLDNGYFEEETSDSDSDSDSDSDsdsdsDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1182
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1180814620  164 PDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF012181  1183 DSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 1235
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.43e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.81  E-value: 6.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  803 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 881
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.89e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  805 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 883
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.89e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  811 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 889
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.89e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  795 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 873
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.95e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  809 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 887
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.95e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  813 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 891
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.07e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.07e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  801 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 879
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.31e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.31e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  799 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 877
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.37e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.37e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  797 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 875
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.37e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.37e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  807 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 885
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.44e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.44e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  815 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 893
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 8.03e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 8.03e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  817 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 895
 
Name Accession Description Interval E-value
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
400-528 1.51e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


Pssm-ID: 334238  Cd Length: 127  Bit Score: 90.59  E-value: 1.51e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 400 SVDSQEVNGEDGAARNAVDGNEDTFWHTewdySEPDYPHQIVIDLGSAQEVVGLQYLPRQDGsENGMIKDYEVYVSQDGY 479
Cdd:pfam00754   1 QITASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGE 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1180814620 480 TWGSPVS---SGSWQAGEDEKQITFSGKTGQYVKLVGLSEVNGNPWASAAEI 528
Cdd:pfam00754  76 NWTTVKDdkiPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
231-356 4.30e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


Pssm-ID: 334238  Cd Length: 127  Bit Score: 89.05  E-value: 4.30e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 231 SEETAREDGAVANAIDGDEYTFWHTewsdAEPDYPHEVVIDLGGTYDVSGLRYLPRQDGsENGMIADYEIFVTSDRSNW- 309
Cdd:pfam00754   4 ASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGENWt 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 1180814620 310 --GDPVQTGTWTAAAEQSQTTFENKVGRYVKLVGLSEVNGNPWASAAEI 356
Cdd:pfam00754  79 tvKDDKIPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
F5_F8_type_C pfam00754
F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.
573-701 7.76e-21

F5/8 type C domain; This domain is also known as the discoidin (DS) domain family.


Pssm-ID: 334238  Cd Length: 127  Bit Score: 88.66  E-value: 7.76e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 573 SADSEETYGEDGAARNAADGNEDTFWHTewdyAEPDYPHEIILDLGSSREVVGLHYLPRQDGyENGMIKDYEIYVSQDGY 652
Cdd:pfam00754   1 QITASSSYSGEGPAAAALDGDPNTAWSA----WSGDDPQWIQVDLGKPKKITGVVTQGRQDG-GNGYVKSYKIEYSLDGE 75
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1180814620 653 TWGSPVS---SGSWQAGENEKQVTFSGKTGQYVKLVGLSEVNGNPWASAAEV 701
Cdd:pfam00754  76 NWTTVKDdkiPGNNDNNTPVTNTFDPPIKARYVRITPTSWNTGNGIALRAEL 127
FA58C cd00057
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
572-658 5.22e-13

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 238014  Cd Length: 143  Bit Score: 66.61  E-value: 5.22e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 572 LSADSEETYGedGAARNAaDGNEDTFWHTEWDyaepDYPHEIILDLGSSREVVGLHYLPRQDGYENGMIKDYEIYVSQDG 651
Cdd:cd00057    14 ITASSSYSSG--WEASRA-RLNSDNAWTPAVN----DPPQWLQVDLGKTRRVTGIQTQGRKGGGSSEWVTSYKVQYSLDG 86

                  ....*..
gi 1180814620 652 YTWGSPV 658
Cdd:cd00057    87 ETWTTYK 93
FA58C cd00057
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
399-485 5.64e-13

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 238014  Cd Length: 143  Bit Score: 66.61  E-value: 5.64e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 399 LSVDSQEvnGEDGAARNAvDGNEDTFWHTEWDysepDYPHQIVIDLGSAQEVVGLQYLPRQDGSENGMIKDYEVYVSQDG 478
Cdd:cd00057    14 ITASSSY--SSGWEASRA-RLNSDNAWTPAVN----DPPQWLQVDLGKTRRVTGIQTQGRKGGGSSEWVTSYKVQYSLDG 86

                  ....*..
gi 1180814620 479 YTWGSPV 485
Cdd:cd00057    87 ETWTTYK 93
FA58C cd00057
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
228-347 1.30e-11

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 238014  Cd Length: 143  Bit Score: 62.75  E-value: 1.30e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 228 STDSEETAredgavANAIDGDEYTFWHTEWSDaepdYPHEVVIDLGGTYDVSGLRYLPRQDGSENGMIADYEIFVTSDRS 307
Cdd:cd00057    18 SSYSSGWE------ASRARLNSDNAWTPAVND----PPQWLQVDLGKTRRVTGIQTQGRKGGGSSEWVTSYKVQYSLDGE 87
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 1180814620 308 NWGDPVQ-----TGTWTAAAEQSQTTFENK--VGRYVKLVGLSEVNG 347
Cdd:cd00057    88 TWTTYKDkgeekVFTGNSDGSTPVTNDFPPpiVARYIRILPTTWNGN 134
FN3 smart00060
Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, ...
44-122 3.85e-07

Fibronectin type 3 domain; One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.


Pssm-ID: 214495 [Multi-domain]  Cd Length: 83  Bit Score: 47.99  E-value: 3.85e-07
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1180814620   44 PVLFLASSGSHAASVQLSWDKVNDSRVEGYNIYYGPSGTSYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADG 122
Cdd:smart00060   3 PPSNLRVTDVTSTSVTLSWEPPPDDGITGYIVGYRVEYREEGSEWKEVNVTPSSTSYTLTGLKPGTEYEFRVRAVNGAG 81
FA58C smart00231
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
237-360 1.08e-06

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 214572  Cd Length: 139  Bit Score: 48.27  E-value: 1.08e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  237 EDGAVANAIDGDEYTFWHTewsdAEPDYPHEVVIDLGGTYDVSGLRYlPRQDGSENGMIadYEIFVTSDRSNWGDPVQTG 316
Cdd:smart00231  20 YWAAKIARLNGGSDGGWCP----AKNDLPPWIQVDLGRLRTVTGVIT-GRRHGNGDWVT--YKLEYSDDGVNWTTYKDGN 92
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|
gi 1180814620  317 --TWTAAAEQSQTTFEN----KVGRYVKLVGLSEVNGNpwasAAEITLLG 360
Cdd:smart00231  93 skVFPGNSDAGTVVLNDfpppIVARYVRILPTGWNGNI----ILRVELLG 138
FN3 cd00063
Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein ...
57-131 1.63e-06

Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.


Pssm-ID: 238020 [Multi-domain]  Cd Length: 93  Bit Score: 46.72  E-value: 1.63e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1180814620  57 SVQLSWDKVND--SRVEGYNIYYGPSGTSYTVQEdqTVTDRDQTTCTISGLEEGQIYGFTATSFDADGnESDFSSHV 131
Cdd:cd00063    16 SVTLSWTPPEDdgGPITGYVVEYREKGSGDWKEV--EVTPGSETSYTLTGLKPGTEYEFRVRAVNGGG-ESPPSESV 89
FA58C smart00231
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
406-489 3.39e-05

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 214572  Cd Length: 139  Bit Score: 44.04  E-value: 3.39e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  406 VNGEDGAARNAVDGNEDTFWHTEwdysEPDYPHQIVIDLGSAQEVVGLQYlPRQDGSENGMIkdYEVYVSQDGYTWGSPV 485
Cdd:smart00231  17 SSSYWAAKIARLNGGSDGGWCPA----KNDLPPWIQVDLGRLRTVTGVIT-GRRHGNGDWVT--YKLEYSDDGVNWTTYK 89

                   ....
gi 1180814620  486 SSGS 489
Cdd:smart00231  90 DGNS 93
FA58C smart00231
Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached ...
580-706 4.40e-05

Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.


Pssm-ID: 214572  Cd Length: 139  Bit Score: 43.65  E-value: 4.40e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  580 YGEDGAARNAADGNEDTFWHTewdyAEPDYPHEIILDLGSSREVVGLhYLPRQDGYENGMIkdYEIYVSQDGYTWGSPVS 659
Cdd:smart00231  18 SSYWAAKIARLNGGSDGGWCP----AKNDLPPWIQVDLGRLRTVTGV-ITGRRHGNGDWVT--YKLEYSDDGVNWTTYKD 90
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*..
gi 1180814620  660 SGSwqagenekqVTFSGKTGqyvklvglsevNGNPWASAAEVGIVAR 706
Cdd:smart00231  91 GNS---------KVFPGNSD-----------AGTVVLNDFPPPIVAR 117
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
89-215 6.29e-05

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 46.36  E-value: 6.29e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  89 DQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGN-ESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGTDPDTA 167
Cdd:NF000535  697 DVTITDHDDFTLDNGYYEEETSDSDSDSDSDSDSDsDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 776
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 1180814620 168 DTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  777 DSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 825
DUF4998 pfam16389
Domain of unknown function; This family around 200 residues locates in the N-terminal of some ...
58-132 2.63e-04

Domain of unknown function; This family around 200 residues locates in the N-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.


Pssm-ID: 318580  Cd Length: 198  Bit Score: 42.65  E-value: 2.63e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1180814620  58 VQLSWDKVNDSRVEGYNIYYGPSGTSYTVQEDQTvTDRDQTTCTISGLEEGQiYGFTATSFDADGNES---DFSSHVY 132
Cdd:pfam16389  35 VKLTWLLVSDPKITKARIFWNNGKDSLEVPVART-AGVDTISVIIDNLPEGS-YTFSIVTYDDEGNKSlpsEVTGTVY 110
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
82-215 2.70e-04

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 44.05  E-value: 2.70e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  82 TSYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGNESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHG 161
Cdd:NF000535  717 TSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 796
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 1180814620 162 TDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  797 DSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 851
fn3 pfam00041
Fibronectin type III domain;
57-123 3.79e-04

Fibronectin type III domain;


Pssm-ID: 333790  Cd Length: 84  Bit Score: 39.70  E-value: 3.79e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1180814620  57 SVQLSWD--KVNDSRVEGYNIYYGPSGTSYTVQEDQTvtDRDQTTCTISGLEEGQIYGFTATSFDADGN 123
Cdd:pfam00041  15 SLTVSWTppPDGNGPITGYRVEYRPVNGGEPWNEITV--PGTTTSVTLTGLRPGTEYEVRVQAVNGGGE 81
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
87-215 1.16e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 42.12  E-value: 1.16e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  87 QEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGNESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGTDPDT 166
Cdd:NF000535  714 EEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 793
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 1180814620 167 ADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  794 SDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 843
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
76-215 1.58e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 41.74  E-value: 1.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  76 YYGPSGTSYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGNESDFSSHVYYNVPESADDQDSLDSDGDGLTDS 155
Cdd:NF000535  713 YEEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 792
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1180814620 156 EEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  793 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 853
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-244 2.35e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 40.97  E-value: 2.35e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  823 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 901
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 1180814620 216 IELVPQAQMRILSTDSE---------ETAREDGAVANA 244
Cdd:NF000535  902 SDAGKHTPAKPMSTVKDhhnkakalpETGSENNGSNNA 939
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
83-215 4.58e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 40.20  E-value: 4.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620  83 SYTVQEDQTVTDRDQTTCTISGLEEGQIYGFTATSFDADGNESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGT 162
Cdd:NF000535  730 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 809
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1180814620 163 DPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  810 SDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 863
MSCRAMM_SdrD NF012181
MSCRAMM family adhesin SdrD; Features of this protein family include a YSIRK-type signal ...
89-215 5.27e-03

MSCRAMM family adhesin SdrD; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333730 [Multi-domain]  Cd Length: 1379  Bit Score: 40.18  E-value: 5.27e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620   89 DQTVTDRDQTTCTISGLEEGQIYGFTATSFDAD-----GNESDFSSHVYYNVPESADDQDSLDSDGDGLTDSEEETHGTD 163
Cdd:NF012181  1103 DVTITDHDDFTLDNGYFEEETSDSDSDSDSDSDsdsdsDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 1182
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1180814620  164 PDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF012181  1183 DSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 1235
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.43e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.81  E-value: 6.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  803 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 881
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.89e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  805 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 883
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.89e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  811 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 889
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.89e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  795 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 873
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.95e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  809 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 887
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 6.95e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 6.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  813 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 891
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.07e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.07e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  801 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 879
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.31e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.31e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  799 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 877
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.37e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.37e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  797 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 875
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.37e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.37e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  807 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 885
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 7.44e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 7.44e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  815 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 893
MSCRAMM_SdrC NF000535
MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal ...
137-215 8.03e-03

MSCRAMM family adhesin SdrC; Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.


Pssm-ID: 333719 [Multi-domain]  Cd Length: 963  Bit Score: 39.43  E-value: 8.03e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1180814620 137 ESADDQDSlDSDGDGLTDSEEETHGTDPDTADTDGDGLTDGEEVNTYDTDPTS-ADTDGDGTEDGEEVSQGSDPLQADSD 215
Cdd:NF000535  817 DSDSDSDS-DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSdSDSDSDSDSDSDSDSDSDSDSDSDSD 895
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH