NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1119624474|ref|WP_072546034|]
View 

response regulator [Mediterranea massiliensis]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BaeS COG0642
Signal transduction histidine kinase [Signal transduction mechanisms];
935-1167 1.24e-51

Signal transduction histidine kinase [Signal transduction mechanisms];


:

Pssm-ID: 223715 [Multi-domain]  Cd Length: 336  Bit Score: 185.34  E-value: 1.24e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  935 KHRVAMEQQLTHMKLRFFTDISHELRTPLTLITGPLEyVLQNTKLPaEAREQLQVVERNSNRMLRLVNQILDFRKI-QNK 1013
Cdd:COG0642    102 ELLERLERLLRRAKREFLANISHELRTPLTAIRGLLE-LLLEGLLD-PQRELLEIIEEEAERLLRLVNDLLDLSRLeAGT 179
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1014 KMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEkEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKmITVFVHDNG 1093
Cdd:COG0642    180 KLKLLLELVDLAELLEEVVRLLAPLAQEKGIELAVDLP-ELPYVLGDPERLRQVLVNLLSNAIKYTPGGE-ITISVRQDD 257
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1119624474 1094 QTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSlfnqSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:COG0642    258 EQVTISVEDTGPGIPEEELERIFEPFFRTDKSR----SGTGLGLAIVKRIVELHGGTISVESEPGKGTTFTIRL 327
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
1223-1336 1.18e-34

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088 [Multi-domain]  Cd Length: 113  Bit Score: 128.46  E-value: 1.18e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLTAK 1301
Cdd:cd00156      1 LIVDDDPLIRELLRRLLEKEgYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKR--GPDIPIIFLTAH 78
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 1119624474 1302 TAIESMLEGLEYGADDYITKPFSATYLKARVRNIL 1336
Cdd:cd00156     79 GDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
YesN super family cl34812
Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding ...
1221-1479 4.50e-25

Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription];


The actual alignment was detected with superfamily member COG4753:

Pssm-ID: 227095 [Multi-domain]  Cd Length: 475  Bit Score: 110.53  E-value: 4.50e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1221 TMLLVEDNTELRTFLRSIF---ASEFRVV-EAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIpmV 1296
Cdd:COG4753      3 KVLIVDDEPLIREGLKSLIdweALGIEVVgTAANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQSPDTEF--I 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1297 LLTAKTAIESMLEGLEYGADDYITKPFSATYLKA---RVRNILERRKK---LQEMYREKLMN---MATSPDEPTVEESKA 1367
Cdd:COG4753     81 ILSGYDEFEYAKKAMKLGVKDYLLKPVDKAELEEalkKIIGKLEEQQKvkqDIEKLLTLLIGhepLEELAKKIYKWEGAT 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1368 PEMSpNDRKFMDKL-------------MALMEKNLDNGDLIVDDLVKDMAVSRSVFFKKlksltglapvefikemRINRA 1434
Cdd:COG4753    161 GIQS-QLADSQRTLkdlaehlelspsyLSQLFKEEVGLFILERFLIRSAPFQEYGLLRK----------------RLEQA 223
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|..
gi 1119624474 1435 VQLIETGEYSM-------TQIAYMVGINDPRYFSKCFKQKMGMTPTEYRDRK 1479
Cdd:COG4753    224 KLLLVTSEQVSiyvlkvyREIAEKLGFEEADYFDYRFKKYLGMTPDQYNKQL 275
Y_Y_Y pfam07495
Y_Y_Y domain; This domain is mostly found at the end of the beta propellers (pfam07494) in a ...
836-900 3.97e-20

Y_Y_Y domain; This domain is mostly found at the end of the beta propellers (pfam07494) in a family of two component regulators. However they are also found tandemly repeated in CTC_02402 without other signal conduction domains being present. It's named after the conserved tyrosines found in the alignment. The exact function is not known.


:

Pssm-ID: 284830  Cd Length: 65  Bit Score: 85.10  E-value: 3.97e-20
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1119624474  836 DYTNPSDIQYAYMLDGFEKNWNYVGKQRTATYTNLPKGHYVFKVRSTNADGVWSDNVRTLDIEVL 900
Cdd:pfam07495    1 NYDGPENLLYRYRLEGFDGEWVELGDYSEASYTNLPPGKYTLKVKAKDKDGNWSYDDASLNFTIL 65
COG3292 super family cl27077
Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];
414-793 4.99e-17

Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];


The actual alignment was detected with superfamily member COG3292:

Pssm-ID: 225829 [Multi-domain]  Cd Length: 671  Bit Score: 86.48  E-value: 4.99e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  414 DRQGNLWMcTHSKGLEKVTFRT------DRFRLKVPVNHSYEslsnevralceDKDGNMWVGLKDGmlrvynrhreeIGY 487
Cdd:COG3292    173 DANGRLWV-GTPDGLSYFDAGRgkalqlASPPLDKAINALIA-----------DVQGRLWVGTDQG-----------VYL 229
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  488 LTEAGTVSHSGKPLF--GNTYFVMQDSHDNLWIATKGAGVVKAEPLPGtLRYRL--TRYRYSAddvyslsddnVYCLYED 563
Cdd:COG3292    230 QEAEGWRASNWGPMLpsGNILLLVQDAQGELWIGTENGLWRTRLPRQG-LQIPLskMHLGVST----------VNSLWLD 298
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  564 RRGRIWVATFANGISYLTRNADGKEVFishrNNLKGFPIKYCskvRCITGDADGHIWIGTTVGLLMVDDGFDRpEDARFY 643
Cdd:COG3292    299 TDGSLWVGTYGGIVRYLTADWKRMAVI----NDSDGGVSQYE---AVAPALLSWGVRQLNSIGELMVANGSTG-ELVRSV 370
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  644 HYLRApekanalsnNDIHWVKPTREGELYVATFGGGLNQLvDLNAEGqarfKAYTVRDGLPSDILLSIQEDKKGQLWIST 723
Cdd:COG3292    371 HQLRG---------MNITTTLEDSRGRLWLGSMQNGLSRL-DNKNEW----AVLDEDAGLPSSEVSAIVEDPDNSLWIGT 436
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1119624474  724 ENGLSKFTPGLGRFEN---FQNKYSNSSIrfsEAASAYASDGNILFGTNHGIFYFnpdSIQKSVYVPPIVLTQ 793
Cdd:COG3292    437 SGGLVKRDPESGRVLNllnPGSHGLDGSR---VEQLGLGPDGRLWLAAGSGVAAW---ESQRRMFVPILDLTG 503
COG3292 super family cl27077
Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];
9-579 6.01e-13

Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];


The actual alignment was detected with superfamily member COG3292:

Pssm-ID: 225829 [Multi-domain]  Cd Length: 671  Bit Score: 73.38  E-value: 6.01e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474    9 MLAVLTAAVLKAQPEGS-FTHYSSDDGLSENTVMDMLQDSRGNMWFSTWNGINKFDGYT-FKTFKarQDNQIALTSNRVD 86
Cdd:COG3292     10 LVLVILSTATAAVPEMSrFRVLDATSGLPSNVVRAMLQDADGYLWLATSDGLVRYDGPNdFGVFP--GNSVLGLYPDGTR 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474   87 N-MKLDRYGFIWLQTYDDRAFRFDPRTEVFESVPaegePGSQTAIssikVLPDGTVWLltrreGAVRITTDSTDYrLTSV 165
Cdd:COG3292     88 LlLVSSENGLLALGALGRRDFIQVYRGGVAKSDA----LHELTAL----IDDAQLLWL-----HASVIGVDSADA-LGRE 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  166 WYSPASERLRVSRVFD-VCQADGAEWVLSDNGLvcftpdgaepviyfenaeegkdsfkkrqsfyvmedcgdcllfgsgng 244
Cdd:COG3292    154 AVKDVRPLLKDTPVVAlVFDANGRLWVGTPDGL----------------------------------------------- 186
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  245 tvwvYRKKDRTFRPVQLDAASRISGIKHL--KKLSQVVVATvSDGFFVYDLPTGRTEHYaASRLPAEKVKSIYRDLSDEI 322
Cdd:COG3292    187 ----SYFDAGRGKALQLASPPLDKAINALiaDVQGRLWVGT-DQGVYLQEAEGWRASNW-GPMLPSGNILLLVQDAQGEL 260
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  323 WF--EQDVVGEVAHFNP--YTRKLKCEKVYAeptntdrsrpAFHIHEDIFGTLWVHPYGGGFSY-----------FDRKN 387
Cdd:COG3292    261 WIgtENGLWRTRLPRQGlqIPLSKMHLGVST----------VNSLWLDTDGSLWVGTYGGIVRYltadwkrmaviNDSDG 330
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  388 NCLRPFYNSMTGENW--RFSNKIHsafsdrqgnlwMCTHSKGLEKVTFRTdRFRLKvPVNhsyeslsneVRALCEDKDGN 465
Cdd:COG3292    331 GVSQYEAVAPALLSWgvRQLNSIG-----------ELMVANGSTGELVRS-VHQLR-GMN---------ITTTLEDSRGR 388
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  466 MWVG-LKDGMLRVYNrhREEIGYLTEAgtvshSGKPLfGNTYFVMQDSHDNLWIATKGaGVVKAEPLPGTLRYRLtryry 544
Cdd:COG3292    389 LWLGsMQNGLSRLDN--KNEWAVLDED-----AGLPS-SEVSAIVEDPDNSLWIGTSG-GLVKRDPESGRVLNLL----- 454
                          570       580       590
                   ....*....|....*....|....*....|....*
gi 1119624474  545 sADDVYSLSDDNVYCLYEDRRGRIWVAtFANGISY 579
Cdd:COG3292    455 -NPGSHGLDGSRVEQLGLGPDGRLWLA-AGSGVAA 487
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
900-937 7.01e-03

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd14966:

Pssm-ID: 355774  Cd Length: 259  Bit Score: 39.79  E-value: 7.01e-03
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 1119624474  900 LPSFWETPLAYFLYVLFFLLI-IVTAVYILFTIYRLKHR 937
Cdd:cd14966    144 YPAIYNSWPALVLVYIWPLIIsLIAAVYAVLTLRRFFRR 182
 
Name Accession Description Interval E-value
BaeS COG0642
Signal transduction histidine kinase [Signal transduction mechanisms];
935-1167 1.24e-51

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 223715 [Multi-domain]  Cd Length: 336  Bit Score: 185.34  E-value: 1.24e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  935 KHRVAMEQQLTHMKLRFFTDISHELRTPLTLITGPLEyVLQNTKLPaEAREQLQVVERNSNRMLRLVNQILDFRKI-QNK 1013
Cdd:COG0642    102 ELLERLERLLRRAKREFLANISHELRTPLTAIRGLLE-LLLEGLLD-PQRELLEIIEEEAERLLRLVNDLLDLSRLeAGT 179
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1014 KMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEkEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKmITVFVHDNG 1093
Cdd:COG0642    180 KLKLLLELVDLAELLEEVVRLLAPLAQEKGIELAVDLP-ELPYVLGDPERLRQVLVNLLSNAIKYTPGGE-ITISVRQDD 257
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1119624474 1094 QTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSlfnqSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:COG0642    258 EQVTISVEDTGPGIPEEELERIFEPFFRTDKSR----SGTGLGLAIVKRIVELHGGTISVESEPGKGTTFTIRL 327
HK_WalK NF033092
cell wall metabolism sensor histidine kinase WalK; This model describes WalK as found in ...
941-1163 3.90e-42

cell wall metabolism sensor histidine kinase WalK; This model describes WalK as found in Staphylococcus aureus (sp|Q2G2U4.1|WALK_STAA8). A shorter version, as found in Streptococcus pneumoniae, called WalK(Spn) or VicK, is not included. WalK is part of a two-component system and works with partner protein


Pssm-ID: 333752 [Multi-domain]  Cd Length: 594  Bit Score: 164.15  E-value: 3.90e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  941 EQQLTHMKLR-FFTDISHELRTPLTLITGPLEYV----LQNTKLpaeAREQLQVVERNSNRMLRLVNQILDFRKIQNKKM 1015
Cdd:NF033092   364 EQEKIEQERReFVANVSHELRTPLTTMRSYLEALadgaWKDPEL---APRFLGVTQNETERMIRLVNDLLQLSRMDSKDY 440
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1016 KMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQT 1095
Cdd:NF033092   441 KLNKEWVNFNEFFNYIIDRFEMILKNKNITFKREFPKRDLWVEIDTDKITQVLDNIISNAIKYSPEGGTITFRLLETHNR 520
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1096 VSVGVQDQGIGIAENKKKSLFVRFENlVD---SSlfNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCF 1163
Cdd:NF033092   521 IIISISDQGLGIPKKDLDKIFDRFYR-VDkarSR--KMGGTGLGLAIAKEVVEAHGGRIWAESEEGKGTTI 588
phoR_proteo TIGR02966
phosphate regulon sensor kinase PhoR; Members of this protein family are the regulatory ...
942-1167 3.17e-41

phosphate regulon sensor kinase PhoR; Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems]


Pssm-ID: 274368 [Multi-domain]  Cd Length: 333  Bit Score: 155.06  E-value: 3.17e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  942 QQLTHMKLRFFTDISHELRTPLTLITGPLEYVLQNTKLPAEAREQ-LQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQ 1020
Cdd:TIGR02966  108 RRLEQMRRDFVANVSHELRTPLTVLRGYLETLADGPDEDPEEWNRaLEIMLEQSQRMQSLVEDLLTLSRLESAASPLEDE 187
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1021 RLEIVAFVRKIMDNFEAVAEEHHIDFVFETEkEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGV 1100
Cdd:TIGR02966  188 PVDMPALLDHLRDEAEALSQGKNHQITFEID-GGVDVLGDEDELRSAFSNLVSNAIKYTPEGGTITVRWRRDGGGAEFSV 266
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1119624474 1101 QDQGIGIAENKKKSLFVRFENlVDSSLFNQSS-SGIGLSLVKELVEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:TIGR02966  267 TDTGIGIAPEHLPRLTERFYR-VDKSRSRDTGgTGLGLAIVKHVLSRHHARLEIESELGKGSTFSFIF 333
PRK09959 PRK09959
hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
945-1335 9.83e-35

hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional


Pssm-ID: 182169 [Multi-domain]  Cd Length: 1197  Bit Score: 144.88  E-value: 9.83e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  945 THMKLRFFTDISHELRTPLTLITGPLEyVLQNTKLPAEAR-EQLQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLE 1023
Cdd:PRK09959   709 TVAKSQFLATMSHEIRTPISSIMGFLE-LLSGSGLSKEQRvEAISLAYATGQSLLGLIGEILDVDKIESGNYQLQPQWVD 787
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1024 IVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVYLW-VDADKFEKIVYNLLSNAFKYTPEG--KMITVFVH--DNGQTVSV 1098
Cdd:PRK09959   788 IPTLVQNTCHSFGAIAASKSIALSCSSTFPDHYLVkIDPQAFKQVLSNLLSNALKFTTEGavKITTSLGHidDNHAVIKM 867
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1099 GVQDQGIGIAENKKKSLFVRFENlvDSSLFNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKVDFqkgkehydeTV 1178
Cdd:PRK09959   868 TIMDSGSGLSQEEQQQLFKRYSQ--TSAGRQQTGSGLGLMICKELIKNMQGDLSLESHPGIGTTFTITI---------PV 936
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1179 EFLQNdVEQGGAKQEQQTAVEDngasegnkgeegtentdvRSTMLLVEDNTELRTFL-RSIFASEFRVVEAANGAEGLEK 1257
Cdd:PRK09959   937 EISQQ-VATVEAKAEQPITLPE------------------KLSILIADDHPTNRLLLkRQLNLLGYDVDEATDGVQALHK 997
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1119624474 1258 ALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNI 1335
Cdd:PRK09959   998 VSMQHYDLLITDVNMPNMDGFELTRKLREQ--NSSLPIWGLTANAQANEREKGLSCGMNLCLFKPLTLDVLKTHLSQL 1073
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
1223-1336 1.18e-34

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088 [Multi-domain]  Cd Length: 113  Bit Score: 128.46  E-value: 1.18e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLTAK 1301
Cdd:cd00156      1 LIVDDDPLIRELLRRLLEKEgYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKR--GPDIPIIFLTAH 78
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 1119624474 1302 TAIESMLEGLEYGADDYITKPFSATYLKARVRNIL 1336
Cdd:cd00156     79 GDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
1223-1344 2.32e-29

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 117.40  E-value: 2.32e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLvPDIIISDVMMPEKDGLQMMRELHDNmTTSHIPMVLLTAK 1301
Cdd:COG0745      4 LLVEDDPELAELLKEYLEEEgYEVDVAADGEEALEAAREQ-PDLVLLDLMLPDLDGLELCRRLRAK-KGSGPPIIVLTAR 81
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 1119624474 1302 TAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQE 1344
Cdd:COG0745     82 DDEEDRVLGLEAGADDYLTKPFSPRELLARLRALLRRNAGASR 124
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
1060-1167 1.12e-28

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643 [Multi-domain]  Cd Length: 111  Bit Score: 111.20  E-value: 1.12e-28
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  1060 DADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENlVDSSLFNQSSSGIGLSL 1139
Cdd:smart00387    2 DPDRLRQVLSNLLDNAIKYTPEGGRITVTLERDGDHVEITVEDNGPGIPPEDLEKIFEPFFR-TDKRSRKIGGTGLGLSI 80
                            90       100
                    ....*....|....*....|....*...
gi 1119624474  1140 VKELVEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:smart00387   81 VKKLVELHGGEISVESEPGGGTTFTITL 108
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
1223-1333 5.06e-27

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 333815 [Multi-domain]  Cd Length: 111  Bit Score: 106.46  E-value: 5.06e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLTAK 1301
Cdd:pfam00072    2 LIVDDDPLIRELLRQLLEKEgYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRR--DPTTPVIILTAH 79
                           90       100       110
                   ....*....|....*....|....*....|..
gi 1119624474 1302 TAIESMLEGLEYGADDYITKPFSATYLKARVR 1333
Cdd:pfam00072   80 GDEDDAVEALEAGADDFLSKPFDPDELLAALR 111
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
1220-1387 1.24e-26

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 109.34  E-value: 1.24e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1220 STMLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIPMVLL 1298
Cdd:TIGR02154    3 RRILVVEDEPAIRELIAYNLEKAgYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRRRPETRAIPIIML 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1299 TAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQEMYREKLMNMATSPDEPTVEESKAP-EMSPNDRKF 1377
Cdd:TIGR02154   83 TARGEEEDRVRGLETGADDYITKPFSPRELLARIKAVLRRIRPQLSDEVIEVGDLSLDPVAHRVFRGGQPlSLGPTEFRL 162
                          170
                   ....*....|
gi 1119624474 1378 MDKLMALMEK 1387
Cdd:TIGR02154  163 LHFFMTHPER 172
HATPase cd00075
Histidine kinase-like ATPase domain; This superfamily includes the histidine kinase-like ...
1064-1167 3.21e-26

Histidine kinase-like ATPase domain; This superfamily includes the histidine kinase-like ATPase (HATPase) domains of several ATP-binding proteins such as histidine kinase, DNA gyrase B, topoisomerases, heat shock protein 90 (HSP90), phytochrome-like ATPases and DNA mismatch repair proteins. Domains belonging to this superfamily are also referred to as GHKL (gyrase, heat-shock protein 90, histidine kinase, MutL) ATPase domains.


Pssm-ID: 340391 [Multi-domain]  Cd Length: 102  Bit Score: 103.84  E-value: 3.21e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1064 FEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSlfNQSSSGIGLSLVKEL 1143
Cdd:cd00075      1 LEQVLSNLLDNALKYSPPGGTIEISLRQEGDGVVLEVEDNGPGIPEEDLERIFERFYRGDKSR--EGGGTGLGLAIVRRI 78
                           90       100
                   ....*....|....*....|....
gi 1119624474 1144 VEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:cd00075     79 VEAHGGRITVESEPGGGTTFTVTL 102
HK_VicK NF033093
cell wall metabolism sensor histidine kinase VicK; This model describes the protein VicK (or ...
951-1165 2.06e-25

cell wall metabolism sensor histidine kinase VicK; This model describes the protein VicK (or WalK) as found in Streptococcus pneumoniae, This protein is shorter than the WalK of Staphylococcus aureus, although apparently is functionally similar. Compare to model NF033092 (HK_WalK). VicK is a sensor histi


Pssm-ID: 333753 [Multi-domain]  Cd Length: 448  Bit Score: 111.35  E-value: 2.06e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  951 FFTDISHELRTPLTLITGPLEyVLQNTKLPAE-AREQLQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLEIVAFVR 1029
Cdd:NF033093   212 FVSNVSHELRTPLTSVKSYLE-ALDEGALSEPvAPSFIKVSLDETNRMMRMISDLLSLSRIDNQTSHLDVELTNFTAFIT 290
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1030 KIMDNFEAVAEEHHI-----DFVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQG 1104
Cdd:NF033093   291 FILNRFDQIKSQDTEtgkkyEIVRDYPITSIWVEIDTDKMTQVIDNILNNAIKYSPDGGKITVSMKTTDTQLIISISDEG 370
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1105 IGIAENKKKSLFVRFENLVDSSLFNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKV 1165
Cdd:NF033093   371 LGIPKKDLPLIFDRFYRVDKARSRAQGGTGLGLAIAKEIIKQHKGFIWAKSEYGKGSTFTI 431
YesN COG4753
Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding ...
1221-1479 4.50e-25

Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 227095 [Multi-domain]  Cd Length: 475  Bit Score: 110.53  E-value: 4.50e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1221 TMLLVEDNTELRTFLRSIF---ASEFRVV-EAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIpmV 1296
Cdd:COG4753      3 KVLIVDDEPLIREGLKSLIdweALGIEVVgTAANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQSPDTEF--I 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1297 LLTAKTAIESMLEGLEYGADDYITKPFSATYLKA---RVRNILERRKK---LQEMYREKLMN---MATSPDEPTVEESKA 1367
Cdd:COG4753     81 ILSGYDEFEYAKKAMKLGVKDYLLKPVDKAELEEalkKIIGKLEEQQKvkqDIEKLLTLLIGhepLEELAKKIYKWEGAT 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1368 PEMSpNDRKFMDKL-------------MALMEKNLDNGDLIVDDLVKDMAVSRSVFFKKlksltglapvefikemRINRA 1434
Cdd:COG4753    161 GIQS-QLADSQRTLkdlaehlelspsyLSQLFKEEVGLFILERFLIRSAPFQEYGLLRK----------------RLEQA 223
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|..
gi 1119624474 1435 VQLIETGEYSM-------TQIAYMVGINDPRYFSKCFKQKMGMTPTEYRDRK 1479
Cdd:COG4753    224 KLLLVTSEQVSiyvlkvyREIAEKLGFEEADYFDYRFKKYLGMTPDQYNKQL 275
HTH_ARAC smart00342
helix_turn_helix, arabinose operon control protein;
1396-1476 1.99e-23

helix_turn_helix, arabinose operon control protein;


Pssm-ID: 197666 [Multi-domain]  Cd Length: 84  Bit Score: 95.31  E-value: 1.99e-23
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  1396 VDDLVKDMAVSRSVFFKKLKSLTGLAPVEFIKEMRINRAVQLIETGEYSMTQIAYMVGINDPRYFSKCFKQKMGMTPTEY 1475
Cdd:smart00342    4 LEDLAEALGVSPRHLQRLFKKETGTTPKQYLRDRRLERARRLLRDTDLSVTEIALRVGFSSQSYFSRAFKKLFGVTPSEY 83

                    .
gi 1119624474  1476 R 1476
Cdd:smart00342   84 R 84
HATPase_c pfam02518
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the ...
1060-1165 4.21e-23

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 334955 [Multi-domain]  Cd Length: 110  Bit Score: 95.14  E-value: 4.21e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1060 DADKFEKIVYNLLSNAFKYTPEGKmITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENlvDSSLFNQSSSGIGLSL 1139
Cdd:pfam02518    2 DELRLRQVLSNLLDNALKHAKAGE-ITVTLSADGGDLTLTVEDNGIGIPPEDLPRIFEPFST--DSSTRGGGGTGLGLSI 78
                           90       100
                   ....*....|....*....|....*.
gi 1119624474 1140 VKELVEMHKASITVDSKLGEGSCFKV 1165
Cdd:pfam02518   79 VRKLVELMGGTITVESEPGGGTTFTL 104
pleD PRK09581
response regulator PleD; Reviewed
1243-1342 9.70e-22

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 99.98  E-value: 9.70e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1243 FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIPMVLLTAKTAIESMLEGLEYGADDYITKP 1322
Cdd:PRK09581    27 YTVLTASSGAEAIAICEREQPDIILLDVMMPGMDGFEVCRRLKSDPATTHIPVVMVTALDDPEDRVRGLEAGADDFLTKP 106
                           90       100
                   ....*....|....*....|
gi 1119624474 1323 FSATYLKARVRNiLERRKKL 1342
Cdd:PRK09581   107 INDVALFARVKS-LTRLKMV 125
Y_Y_Y pfam07495
Y_Y_Y domain; This domain is mostly found at the end of the beta propellers (pfam07494) in a ...
836-900 3.97e-20

Y_Y_Y domain; This domain is mostly found at the end of the beta propellers (pfam07494) in a family of two component regulators. However they are also found tandemly repeated in CTC_02402 without other signal conduction domains being present. It's named after the conserved tyrosines found in the alignment. The exact function is not known.


Pssm-ID: 284830  Cd Length: 65  Bit Score: 85.10  E-value: 3.97e-20
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1119624474  836 DYTNPSDIQYAYMLDGFEKNWNYVGKQRTATYTNLPKGHYVFKVRSTNADGVWSDNVRTLDIEVL 900
Cdd:pfam07495    1 NYDGPENLLYRYRLEGFDGEWVELGDYSEASYTNLPPGKYTLKVKAKDKDGNWSYDDASLNFTIL 65
HTH_18 pfam12833
Helix-turn-helix domain;
1399-1478 3.91e-19

Helix-turn-helix domain;


Pssm-ID: 338511 [Multi-domain]  Cd Length: 81  Bit Score: 83.02  E-value: 3.91e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1399 LVKDMAVSRSVFFKKLKSLTGLAPVEFIKEMRINRAVQ-LIETGEYSMTQIAYMVGINDPRYFSKCFKQKMGMTPTEYRD 1477
Cdd:pfam12833    1 LAAALGVSPRTLSRLFKRETGLSPKEYLRRLRLERARRlLLEDTGLSVAEIALALGFSSASHFSRAFKRHFGETPSEYRR 80

                   .
gi 1119624474 1478 R 1478
Cdd:pfam12833   81 R 81
COG3292 COG3292
Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];
414-793 4.99e-17

Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];


Pssm-ID: 225829 [Multi-domain]  Cd Length: 671  Bit Score: 86.48  E-value: 4.99e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  414 DRQGNLWMcTHSKGLEKVTFRT------DRFRLKVPVNHSYEslsnevralceDKDGNMWVGLKDGmlrvynrhreeIGY 487
Cdd:COG3292    173 DANGRLWV-GTPDGLSYFDAGRgkalqlASPPLDKAINALIA-----------DVQGRLWVGTDQG-----------VYL 229
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  488 LTEAGTVSHSGKPLF--GNTYFVMQDSHDNLWIATKGAGVVKAEPLPGtLRYRL--TRYRYSAddvyslsddnVYCLYED 563
Cdd:COG3292    230 QEAEGWRASNWGPMLpsGNILLLVQDAQGELWIGTENGLWRTRLPRQG-LQIPLskMHLGVST----------VNSLWLD 298
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  564 RRGRIWVATFANGISYLTRNADGKEVFishrNNLKGFPIKYCskvRCITGDADGHIWIGTTVGLLMVDDGFDRpEDARFY 643
Cdd:COG3292    299 TDGSLWVGTYGGIVRYLTADWKRMAVI----NDSDGGVSQYE---AVAPALLSWGVRQLNSIGELMVANGSTG-ELVRSV 370
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  644 HYLRApekanalsnNDIHWVKPTREGELYVATFGGGLNQLvDLNAEGqarfKAYTVRDGLPSDILLSIQEDKKGQLWIST 723
Cdd:COG3292    371 HQLRG---------MNITTTLEDSRGRLWLGSMQNGLSRL-DNKNEW----AVLDEDAGLPSSEVSAIVEDPDNSLWIGT 436
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1119624474  724 ENGLSKFTPGLGRFEN---FQNKYSNSSIrfsEAASAYASDGNILFGTNHGIFYFnpdSIQKSVYVPPIVLTQ 793
Cdd:COG3292    437 SGGLVKRDPESGRVLNllnPGSHGLDGSR---VEQLGLGPDGRLWLAAGSGVAAW---ESQRRMFVPILDLTG 503
COG3292 COG3292
Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];
9-579 6.01e-13

Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];


Pssm-ID: 225829 [Multi-domain]  Cd Length: 671  Bit Score: 73.38  E-value: 6.01e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474    9 MLAVLTAAVLKAQPEGS-FTHYSSDDGLSENTVMDMLQDSRGNMWFSTWNGINKFDGYT-FKTFKarQDNQIALTSNRVD 86
Cdd:COG3292     10 LVLVILSTATAAVPEMSrFRVLDATSGLPSNVVRAMLQDADGYLWLATSDGLVRYDGPNdFGVFP--GNSVLGLYPDGTR 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474   87 N-MKLDRYGFIWLQTYDDRAFRFDPRTEVFESVPaegePGSQTAIssikVLPDGTVWLltrreGAVRITTDSTDYrLTSV 165
Cdd:COG3292     88 LlLVSSENGLLALGALGRRDFIQVYRGGVAKSDA----LHELTAL----IDDAQLLWL-----HASVIGVDSADA-LGRE 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  166 WYSPASERLRVSRVFD-VCQADGAEWVLSDNGLvcftpdgaepviyfenaeegkdsfkkrqsfyvmedcgdcllfgsgng 244
Cdd:COG3292    154 AVKDVRPLLKDTPVVAlVFDANGRLWVGTPDGL----------------------------------------------- 186
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  245 tvwvYRKKDRTFRPVQLDAASRISGIKHL--KKLSQVVVATvSDGFFVYDLPTGRTEHYaASRLPAEKVKSIYRDLSDEI 322
Cdd:COG3292    187 ----SYFDAGRGKALQLASPPLDKAINALiaDVQGRLWVGT-DQGVYLQEAEGWRASNW-GPMLPSGNILLLVQDAQGEL 260
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  323 WF--EQDVVGEVAHFNP--YTRKLKCEKVYAeptntdrsrpAFHIHEDIFGTLWVHPYGGGFSY-----------FDRKN 387
Cdd:COG3292    261 WIgtENGLWRTRLPRQGlqIPLSKMHLGVST----------VNSLWLDTDGSLWVGTYGGIVRYltadwkrmaviNDSDG 330
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  388 NCLRPFYNSMTGENW--RFSNKIHsafsdrqgnlwMCTHSKGLEKVTFRTdRFRLKvPVNhsyeslsneVRALCEDKDGN 465
Cdd:COG3292    331 GVSQYEAVAPALLSWgvRQLNSIG-----------ELMVANGSTGELVRS-VHQLR-GMN---------ITTTLEDSRGR 388
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  466 MWVG-LKDGMLRVYNrhREEIGYLTEAgtvshSGKPLfGNTYFVMQDSHDNLWIATKGaGVVKAEPLPGTLRYRLtryry 544
Cdd:COG3292    389 LWLGsMQNGLSRLDN--KNEWAVLDED-----AGLPS-SEVSAIVEDPDNSLWIGTSG-GLVKRDPESGRVLNLL----- 454
                          570       580       590
                   ....*....|....*....|....*....|....*
gi 1119624474  545 sADDVYSLSDDNVYCLYEDRRGRIWVAtFANGISY 579
Cdd:COG3292    455 -NPGSHGLDGSRVEQLGLGPDGRLWLA-AGSGVAA 487
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
1223-1273 1.54e-12

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668 [Multi-domain]  Cd Length: 55  Bit Score: 63.36  E-value: 1.54e-12
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|..
gi 1119624474  1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMP 1273
Cdd:smart00448    4 LVVDDDPLLRELLKALLEKEgYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK10572 PRK10572
DNA-binding transcriptional regulator AraC; Provisional
1430-1483 1.13e-08

DNA-binding transcriptional regulator AraC; Provisional


Pssm-ID: 236717 [Multi-domain]  Cd Length: 290  Bit Score: 58.06  E-value: 1.13e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 1119624474 1430 RINRAVQLIETGEYSMTQIAYMVGINDPRYFSKCFKQKMGMTPTEYRDRKAGKN 1483
Cdd:PRK10572   236 RISRAKLLLQTTRMPIATIGRNVGYDDQLYFSRVFKKCTGASPSEFRARCEEKN 289
HpaA TIGR02297
4-hydroxyphenylacetate catabolism regulatory protein HpaA; This putative transcriptional ...
1373-1478 1.99e-08

4-hydroxyphenylacetate catabolism regulatory protein HpaA; This putative transcriptional regulator, which contains both the substrate-binding, dimerization domain (pfam02311) and the helix-turn-helix DNA-binding domain (pfam00165) of the AraC famil, is located proximal to genes of the 4-hydroxyphenylacetate catabolism pathway.


Pssm-ID: 131350 [Multi-domain]  Cd Length: 287  Bit Score: 57.12  E-value: 1.99e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1373 NDRKFMDKLMALMEKNLDNgDLIVDDLVKDMAVSRSVFFKKLKSLTGLAPVEFIKEMRINRAVQLIETGEYSMTQIAYMV 1452
Cdd:TIGR02297  183 NELYLFNRFNFLIEENYKQ-HLRLPEYADRLGISESRLNDICRRFSALSPKRLIIERVMQEARRLLLFTQHSINQIAYDL 261
                           90       100
                   ....*....|....*....|....*.
gi 1119624474 1453 GINDPRYFSKCFKQKMGMTPTEYRDR 1478
Cdd:TIGR02297  262 GYKDPAYFARFFQKETGLSPSAFRDR 287
Reg_prop pfam07494
Two component regulator propeller; A large group of two component regulator proteins appear to ...
551-573 1.63e-04

Two component regulator propeller; A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats. These repeats show homology to pfam01011 and pfam00400 indicating that they are likely to form a beta-propeller. This family has been built with artificially high cut-offs in order to avoid overlaps with other beta-propeller families. The fourteen repeats are likely to form two propellers; it is not clear if these structures are likely to recruit other proteins or interact with DNA.


Pssm-ID: 311438  Cd Length: 24  Bit Score: 39.99  E-value: 1.63e-04
                           10        20
                   ....*....|....*....|...
gi 1119624474  551 SLSDDNVYCLYEDRRGRIWVATF 573
Cdd:pfam07494    1 GLPSNSVTSLLEDSDGRLWIGTN 23
Reg_prop pfam07494
Two component regulator propeller; A large group of two component regulator proteins appear to ...
34-57 2.03e-03

Two component regulator propeller; A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats. These repeats show homology to pfam01011 and pfam00400 indicating that they are likely to form a beta-propeller. This family has been built with artificially high cut-offs in order to avoid overlaps with other beta-propeller families. The fourteen repeats are likely to form two propellers; it is not clear if these structures are likely to recruit other proteins or interact with DNA.


Pssm-ID: 311438  Cd Length: 24  Bit Score: 36.91  E-value: 2.03e-03
                           10        20
                   ....*....|....*....|....
gi 1119624474   34 GLSENTVMDMLQDSRGNMWFSTWN 57
Cdd:pfam07494    1 GLPSNSVTSLLEDSDGRLWIGTNG 24
7tmD_STE3 cd14966
fungal a-factor pheromone receptor STE3, member of the class D family of seven-transmembrane G ...
900-937 7.01e-03

fungal a-factor pheromone receptor STE3, member of the class D family of seven-transmembrane G protein-coupled receptors; This subfamily represents the a-factor pheromone receptor encoded by the STE3 gene, which is required for pheromone sensing and mating in haploid cells of the yeast Saccharomyces cerevisiae. The STE3-encoded seven-transmembrane domain receptor is a member of the class D GPCRs. Class D receptors are composed of two major subfamilies: Ste2 and Ste3. These two GPCRs (Ste2 and Ste3) sense the polypeptide mating pheromones, alpha-factor and a-factor, which activate a G protein-coupled receptors on the surface of the opposite yeast-mating haploid-types (MATa and MAT-alpha), respectively. Activation of these receptors by pheromones leads to activation of the mitogen-activated protein kinase (MAPK) signal transduction cascades, G1 cell cycle arrest, and polarized cell growth in the direction of the partner cell (a process called shmooing), which ultimately induces cell-cell fusion and the formation of a diploid zygote. Like all GPCRs, these pheromone mating factor receptors possess the same basic architecture of seven-transmembrane (7TM) domains and share common signaling mechanisms; however, there is no significant sequence similarity either between Ste2 and Ste3, or between these two receptors and the other 7TM GPCRs. Thus, STE2 and STE3 represent phylogenetically distinct groups.


Pssm-ID: 320097  Cd Length: 259  Bit Score: 39.79  E-value: 7.01e-03
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 1119624474  900 LPSFWETPLAYFLYVLFFLLI-IVTAVYILFTIYRLKHR 937
Cdd:cd14966    144 YPAIYNSWPALVLVYIWPLIIsLIAAVYAVLTLRRFFRR 182
 
Name Accession Description Interval E-value
BaeS COG0642
Signal transduction histidine kinase [Signal transduction mechanisms];
935-1167 1.24e-51

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 223715 [Multi-domain]  Cd Length: 336  Bit Score: 185.34  E-value: 1.24e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  935 KHRVAMEQQLTHMKLRFFTDISHELRTPLTLITGPLEyVLQNTKLPaEAREQLQVVERNSNRMLRLVNQILDFRKI-QNK 1013
Cdd:COG0642    102 ELLERLERLLRRAKREFLANISHELRTPLTAIRGLLE-LLLEGLLD-PQRELLEIIEEEAERLLRLVNDLLDLSRLeAGT 179
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1014 KMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEkEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKmITVFVHDNG 1093
Cdd:COG0642    180 KLKLLLELVDLAELLEEVVRLLAPLAQEKGIELAVDLP-ELPYVLGDPERLRQVLVNLLSNAIKYTPGGE-ITISVRQDD 257
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1119624474 1094 QTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSlfnqSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:COG0642    258 EQVTISVEDTGPGIPEEELERIFEPFFRTDKSR----SGTGLGLAIVKRIVELHGGTISVESEPGKGTTFTIRL 327
HK_WalK NF033092
cell wall metabolism sensor histidine kinase WalK; This model describes WalK as found in ...
941-1163 3.90e-42

cell wall metabolism sensor histidine kinase WalK; This model describes WalK as found in Staphylococcus aureus (sp|Q2G2U4.1|WALK_STAA8). A shorter version, as found in Streptococcus pneumoniae, called WalK(Spn) or VicK, is not included. WalK is part of a two-component system and works with partner protein


Pssm-ID: 333752 [Multi-domain]  Cd Length: 594  Bit Score: 164.15  E-value: 3.90e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  941 EQQLTHMKLR-FFTDISHELRTPLTLITGPLEYV----LQNTKLpaeAREQLQVVERNSNRMLRLVNQILDFRKIQNKKM 1015
Cdd:NF033092   364 EQEKIEQERReFVANVSHELRTPLTTMRSYLEALadgaWKDPEL---APRFLGVTQNETERMIRLVNDLLQLSRMDSKDY 440
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1016 KMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQT 1095
Cdd:NF033092   441 KLNKEWVNFNEFFNYIIDRFEMILKNKNITFKREFPKRDLWVEIDTDKITQVLDNIISNAIKYSPEGGTITFRLLETHNR 520
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1096 VSVGVQDQGIGIAENKKKSLFVRFENlVD---SSlfNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCF 1163
Cdd:NF033092   521 IIISISDQGLGIPKKDLDKIFDRFYR-VDkarSR--KMGGTGLGLAIAKEVVEAHGGRIWAESEEGKGTTI 588
phoR_proteo TIGR02966
phosphate regulon sensor kinase PhoR; Members of this protein family are the regulatory ...
942-1167 3.17e-41

phosphate regulon sensor kinase PhoR; Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems]


Pssm-ID: 274368 [Multi-domain]  Cd Length: 333  Bit Score: 155.06  E-value: 3.17e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  942 QQLTHMKLRFFTDISHELRTPLTLITGPLEYVLQNTKLPAEAREQ-LQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQ 1020
Cdd:TIGR02966  108 RRLEQMRRDFVANVSHELRTPLTVLRGYLETLADGPDEDPEEWNRaLEIMLEQSQRMQSLVEDLLTLSRLESAASPLEDE 187
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1021 RLEIVAFVRKIMDNFEAVAEEHHIDFVFETEkEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGV 1100
Cdd:TIGR02966  188 PVDMPALLDHLRDEAEALSQGKNHQITFEID-GGVDVLGDEDELRSAFSNLVSNAIKYTPEGGTITVRWRRDGGGAEFSV 266
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1119624474 1101 QDQGIGIAENKKKSLFVRFENlVDSSLFNQSS-SGIGLSLVKELVEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:TIGR02966  267 TDTGIGIAPEHLPRLTERFYR-VDKSRSRDTGgTGLGLAIVKHVLSRHHARLEIESELGKGSTFSFIF 333
VicK COG5002
Signal transduction histidine kinase [Signal transduction mechanisms];
941-1164 1.75e-38

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 227335 [Multi-domain]  Cd Length: 459  Bit Score: 150.66  E-value: 1.75e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  941 EQQLTHMKLRFFT-DISHELRTPLTLITGPLEYV----LQNTKLpaeAREQLQVVERNSNRMLRLVNQILDFRKIQNKKM 1015
Cdd:COG5002    217 EQEKVERERREFVaNVSHELRTPLTSMKSYLEALeegaWEDKEI---APRFLRVTLNETERMIRLVNDLLQLSRMDNARY 293
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1016 KMQVQRLEIVAFVRKIMDNFEAVAEEHHID-FVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQ 1094
Cdd:COG5002    294 QLNKEWINFTAFLNEIINRFEMILKKETIArFVRDIPKQDIWVEIDPDKMTQVLDNIISNALKYSPDGGRITVSVKQRET 373
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1095 TVSVGVQDQGIGIAENKKKSLFVRFENLVDSSLFNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFK 1164
Cdd:COG5002    374 WVEISISDQGLGIPKEDLEKIFDRFYRVDKARSRKMGGTGLGLAIAKEIVQAHGGRIWAESEEGKGTTFS 443
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
934-1372 4.04e-37

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362 [Multi-domain]  Cd Length: 968  Bit Score: 152.24  E-value: 4.04e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  934 LKHRVAMEQ--QLTHMKLRFFTDISHELRTPLTLITGPLEyVLQNTKLPAEAREQLQVVERNSNRMLRLVNQILDFRKIQ 1011
Cdd:TIGR02956  448 KNHAKARAEaeEANRAKSAFLATMSHEIRTPLNGILGTLE-LLGDTGLTSQQQQYLQVINRSGESLLDILNDILDYSKIE 526
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1012 NKKMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVYLWV-DADKFEKIVYNLLSNAFKYTPEGKM-ITVFV 1089
Cdd:TIGR02956  527 AGHLSISPRPFDLNALLDDVHHLMVSRAQLKGIQLRLNIPEQLPNWWQgDGPRIRQVLINLVGNAIKFTDRGSVvLRVSL 606
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1090 HDNGQtVSVGVQDQGIGIAENKKKSLFVRFenlvdSSLFNQSSS---GIGLSLVKELVEMHKASITVDSKLGEGSCFKVd 1166
Cdd:TIGR02956  607 NDDSS-LLFEVEDTGCGIAEEEQATLFDAF-----TQADGRRRSggtGLGLAISQRLVEAMDGELGVESELGVGSCFWF- 679
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1167 fqkgkehydeTVEFLQNDVEQGGAkqeQQTAVEDNGASegnkgeegtentdvrstMLLVEDNTelrtfLRSIFASEF--- 1243
Cdd:TIGR02956  680 ----------TLPLTRGKPAEDSA---TLTVIDLPPQR-----------------VLLVEDNE-----VNQMVAQGFltr 724
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1244 ---RVVEAANGAEGLEKALSLVPDIIISDVMMPEKDG---LQMMRELHDnmTTSHIPMVLLTAKTAIESMLEGLEYGADD 1317
Cdd:TIGR02956  725 lghKVTLAESGQSALECFHQHAFDLALLDINLPDGDGvtlLQQLRAIYG--AKNEVKFIAFSAHVFNEDVAQYLAAGFDG 802
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1119624474 1318 YITKPFSATYLKARVRNILErRKKLQEmyREKLMNMATSPDEPTVEESKAPEMSP 1372
Cdd:TIGR02956  803 FLAKPVVEEQLTAMIAVILA-GGKSNT--EAPVLSASPSFDSASVIENAQADDIP 854
PRK09959 PRK09959
hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
945-1335 9.83e-35

hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional


Pssm-ID: 182169 [Multi-domain]  Cd Length: 1197  Bit Score: 144.88  E-value: 9.83e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  945 THMKLRFFTDISHELRTPLTLITGPLEyVLQNTKLPAEAR-EQLQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLE 1023
Cdd:PRK09959   709 TVAKSQFLATMSHEIRTPISSIMGFLE-LLSGSGLSKEQRvEAISLAYATGQSLLGLIGEILDVDKIESGNYQLQPQWVD 787
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1024 IVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVYLW-VDADKFEKIVYNLLSNAFKYTPEG--KMITVFVH--DNGQTVSV 1098
Cdd:PRK09959   788 IPTLVQNTCHSFGAIAASKSIALSCSSTFPDHYLVkIDPQAFKQVLSNLLSNALKFTTEGavKITTSLGHidDNHAVIKM 867
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1099 GVQDQGIGIAENKKKSLFVRFENlvDSSLFNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKVDFqkgkehydeTV 1178
Cdd:PRK09959   868 TIMDSGSGLSQEEQQQLFKRYSQ--TSAGRQQTGSGLGLMICKELIKNMQGDLSLESHPGIGTTFTITI---------PV 936
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1179 EFLQNdVEQGGAKQEQQTAVEDngasegnkgeegtentdvRSTMLLVEDNTELRTFL-RSIFASEFRVVEAANGAEGLEK 1257
Cdd:PRK09959   937 EISQQ-VATVEAKAEQPITLPE------------------KLSILIADDHPTNRLLLkRQLNLLGYDVDEATDGVQALHK 997
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1119624474 1258 ALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNI 1335
Cdd:PRK09959   998 VSMQHYDLLITDVNMPNMDGFELTRKLREQ--NSSLPIWGLTANAQANEREKGLSCGMNLCLFKPLTLDVLKTHLSQL 1073
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
1223-1336 1.18e-34

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088 [Multi-domain]  Cd Length: 113  Bit Score: 128.46  E-value: 1.18e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLTAK 1301
Cdd:cd00156      1 LIVDDDPLIRELLRRLLEKEgYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKR--GPDIPIIFLTAH 78
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 1119624474 1302 TAIESMLEGLEYGADDYITKPFSATYLKARVRNIL 1336
Cdd:cd00156     79 GDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
PRK11091 PRK11091
aerobic respiration control sensor protein ArcB; Provisional
948-1324 4.57e-32

aerobic respiration control sensor protein ArcB; Provisional


Pssm-ID: 236842 [Multi-domain]  Cd Length: 779  Bit Score: 135.07  E-value: 4.57e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  948 KLRFFTDISHELRTPLTLITGpLEYVLQNTKLPAEAREQLQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLEIVAF 1027
Cdd:PRK11091   283 KTTFISTISHELRTPLNGIVG-LSRILLDTELTAEQRKYLKTIHVSAITLGNIFNDIIDMDKMERRKLQLDNQPIDFTDF 361
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1028 VRKiMDNFEAV-AEEHHIDFVFE-TEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGI 1105
Cdd:PRK11091   362 LAD-LENLSGLqAEQKGLRFDLEpLLPLPHKVITDGTRLRQILWNLISNAVKFTQQGGVTVRVRYEEGDMLTFEVEDSGI 440
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1106 GIAENKKKSLFVRFENlVDSSLFNQSS--SGIGLSLVKELVEMHKASITVDSKLGEGSCFkvdfqkgkehydeTVEFLQN 1183
Cdd:PRK11091   441 GIPEDELDKIFAMYYQ-VKDSHGGKPAtgTGIGLAVSKRLAQAMGGDITVTSEEGKGSCF-------------TLTIHAP 506
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1184 DVeqggAKQEQQTAVEDngasegnkgeegteNTDVRS-TMLLVEDnTELR-TFLRSIFASEFRVVEAA-NGAEGLEKALS 1260
Cdd:PRK11091   507 AV----AEEVEDAFDED--------------DMPLPAlNILLVED-IELNvIVARSVLEKLGNSVDVAmTGKEALEMFDP 567
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1119624474 1261 LVPDIIISDVMMPEKDGLQMMRELHDNMTTSHI-PMVLLTAkTAIESMLEGLEYGADDYITKPFS 1324
Cdd:PRK11091   568 DEYDLVLLDIQLPDMTGLDIARELRERYPREDLpPLVALTA-NVLKDKKEYLDAGMDDVLSKPLS 631
cztS_silS_copS TIGR01386
heavy metal sensor kinase; Members of this family contain a sensor histidine kinase domain ...
940-1167 2.29e-31

heavy metal sensor kinase; Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.


Pssm-ID: 273593 [Multi-domain]  Cd Length: 457  Bit Score: 129.43  E-value: 2.29e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  940 MEQQLTHM---------KL-RFFTDISHELRTPLTLITGPLEYVLQNTKLPAEAREQLQVVERNSNRMLRLVNQILDFRK 1009
Cdd:TIGR01386  223 LAQSFNAMlgrledafqRLsQFSADLAHELRTPLTNLLGQTQVALSQPRTGEEYREVLESNLEELERLSRMVSDMLFLAR 302
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1010 IQNKKMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVylwVDADKFEKIVYNLLSNAFKYTPEGKMITVFV 1089
Cdd:TIGR01386  303 ADNGQLALERVRLDLAAELAKVAEYFEPLAEERGVRIRVEGEGLVR---GDPQMFRRAISNLLSNALRHTPDGGTITVRI 379
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1119624474 1090 HDNGQTVSVGVQDQGIGIAENKKKSLFVRFENlVDSSLFN-QSSSGIGLSLVKELVEMHKASITVDSKLGEgSCFKVDF 1167
Cdd:TIGR01386  380 ERRSDEVRVSVSNPGPGIPPEHLSRLFDRFYR-VDPARSNsGEGTGLGLAIVRSIMEAHGGRASAESPDGK-TRFILRF 456
PRK15347 PRK15347
two component system sensor kinase SsrA; Provisional
948-1344 8.33e-31

two component system sensor kinase SsrA; Provisional


Pssm-ID: 237951 [Multi-domain]  Cd Length: 921  Bit Score: 131.69  E-value: 8.33e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  948 KLRFFTDISHELRTPLTLITGPLEyVLQNTKLPAEAREQLQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLEIVAF 1027
Cdd:PRK15347   398 KSEHLTTISHEIRTPLNGVLGALE-LLQNTPLTAEQMDLADTARQCTLSLLAIINNLLDFSRIESGQMTLSLEETALLPL 476
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1028 VRKIMDNFEAVAEEHHIDF-VFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKmITVFVHDNGQTVSVGVQDQGIG 1106
Cdd:PRK15347   477 LDQAMLTIQGPAQSKSLTLrTFVGAHVPLYLHLDSLRLRQILVNLLGNAVKFTETGG-IRLRVKRHEQQLCFTVEDTGCG 555
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1107 IAENKKKSLFVRFENLVDsslfNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKVD--FQKGKEHYDETVEF---- 1180
Cdd:PRK15347   556 IDIQQQQQIFTPFYQADT----HSQGTGLGLTIASSLAKMMGGELTLFSTPGVGSCFSLVlpLNEYAPPEPLKGELsapl 631
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1181 -LQNDVEQGGAKQE---QQTAVEDNGASE-------------GNKGEEGTENTDV---RSTMLLVEDNTELRTFLRSIFA 1240
Cdd:PRK15347   632 aLHRQLSAWGITCQpghQNPALLDPELAYlpgrlydllqqiiQGAPNEPVINLPLqpwQLQILLVDDVETNRDIIGMMLV 711
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1241 SEFRVVE-AANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHD--NMTTSHIPMVLLTAKTAIESMLEGLEYGADD 1317
Cdd:PRK15347   712 ELGQQVTtAASGTEALELGRQHRFDLVLMDIRMPGLDGLETTQLWRDdpNNLDPDCMIVALTANAAPEEIHRCKKAGMNH 791
                          410       420       430
                   ....*....|....*....|....*....|.
gi 1119624474 1318 YITKPFS----ATYLKARVRNILERRKKLQE 1344
Cdd:PRK15347   792 YLTKPVTlaqlARALELAAEYQLLRGIELSP 822
PRK09835 PRK09835
sensor kinase CusS; Provisional
951-1157 1.64e-29

sensor kinase CusS; Provisional


Pssm-ID: 182101 [Multi-domain]  Cd Length: 482  Bit Score: 124.11  E-value: 1.64e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  951 FFTDISHELRTPLTLITGPLEYVLQNTKLPAEAREQLQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLEIVAFVRK 1030
Cdd:PRK09835   265 FSADIAHEIRTPITNLITQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLDLADEVGK 344
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1031 IMDNFEAVAEEHHIDFVFETEKEAVylWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAEN 1110
Cdd:PRK09835   345 VFDFFEAWAEERGVELRFVGDPCQV--AGDPLMLRRAISNLLSNALRYTPAGEAITVRCQEVDHQVQLVVENPGTPIAPE 422
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*..
gi 1119624474 1111 KKKSLFVRFENLVDSSLFNQSSSGIGLSLVKELVEMHKASITVDSKL 1157
Cdd:PRK09835   423 HLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDA 469
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
1223-1344 2.32e-29

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 117.40  E-value: 2.32e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLvPDIIISDVMMPEKDGLQMMRELHDNmTTSHIPMVLLTAK 1301
Cdd:COG0745      4 LLVEDDPELAELLKEYLEEEgYEVDVAADGEEALEAAREQ-PDLVLLDLMLPDLDGLELCRRLRAK-KGSGPPIIVLTAR 81
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 1119624474 1302 TAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQE 1344
Cdd:COG0745     82 DDEEDRVLGLEAGADDYLTKPFSPRELLARLRALLRRNAGASR 124
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
1060-1167 1.12e-28

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643 [Multi-domain]  Cd Length: 111  Bit Score: 111.20  E-value: 1.12e-28
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  1060 DADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENlVDSSLFNQSSSGIGLSL 1139
Cdd:smart00387    2 DPDRLRQVLSNLLDNAIKYTPEGGRITVTLERDGDHVEITVEDNGPGIPPEDLEKIFEPFFR-TDKRSRKIGGTGLGLSI 80
                            90       100
                    ....*....|....*....|....*...
gi 1119624474  1140 VKELVEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:smart00387   81 VKKLVELHGGEISVESEPGGGTTFTITL 108
KdpD COG2205
K+-sensing histidine kinase KdpD [Signal transduction mechanisms];
937-1176 4.74e-27

K+-sensing histidine kinase KdpD [Signal transduction mechanisms];


Pssm-ID: 225115 [Multi-domain]  Cd Length: 890  Bit Score: 119.70  E-value: 4.74e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  937 RVAMEQQLTHMKLrfFTDISHELRTPLTLITGPLEYVLQN-TKLPAEAR-EQLQVVERNSNRMLRLVNQILDFRKIQNKK 1014
Cdd:COG2205    651 RLAAERERLRSAL--LASISHDLRTPLTAIMGAAETLLLDgEALSPEDRaELLSSIREESERLTRLVTNLLDMTRLQSGG 728
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1015 MKMQVQRLEIVAFVRKIMDNFEAVAEEHHIdfVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQ 1094
Cdd:COG2205    729 VNLKLDWVLVEEVVGEALQRLRKRFTGHKI--VVSVPVDLPLIHVDSPLIEQVLINLLENALKYAPPGSEIRINAGVERE 806
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1095 TVSVGVQDQGIGIAENKKKSLFVRFENLVDSSlfNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKVDF----QKG 1170
Cdd:COG2205    807 NVVFSVIDEGPGIPEGELERIFDKFYRGNKES--ATRGVGLGLAICRGIVEAHGGTISAENNPGGGAIFVFTLpveeDPP 884

                   ....*.
gi 1119624474 1171 KEHYDE 1176
Cdd:COG2205    885 LEDFEE 890
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
1223-1333 5.06e-27

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 333815 [Multi-domain]  Cd Length: 111  Bit Score: 106.46  E-value: 5.06e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLTAK 1301
Cdd:pfam00072    2 LIVDDDPLIRELLRQLLEKEgYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRR--DPTTPVIILTAH 79
                           90       100       110
                   ....*....|....*....|....*....|..
gi 1119624474 1302 TAIESMLEGLEYGADDYITKPFSATYLKARVR 1333
Cdd:pfam00072   80 GDEDDAVEALEAGADDFLSKPFDPDELLAALR 111
phoR PRK11006
phosphate regulon sensor protein; Provisional
938-1163 5.17e-27

phosphate regulon sensor protein; Provisional


Pssm-ID: 182895 [Multi-domain]  Cd Length: 430  Bit Score: 115.88  E-value: 5.17e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  938 VAMEQQLTHMKLRFFTDISHELRTPLTLITGPLEyVLQNTKLPAEAREQ-LQVVERNSNRMLRLVNQILDFRKIQNKKMK 1016
Cdd:PRK11006   194 VTQMHQLEGARRNFFANVSHELRTPLTVLQGYLE-MMQDQPLEGALREKaLHTMREQTQRMEGLVKQLLTLSKIEAAPTI 272
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1017 MQVQRLEIVAFVRKIMDNFEAVAEEHHiDFVFETEKEavyLWV--DADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQ 1094
Cdd:PRK11006   273 DLNEKVDVPMMLRVLEREAQTLSQGKH-TITFEVDNS---LKVfgNEDQLRSAISNLVYNAVNHTPEGTHITVRWQRVPQ 348
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1095 TVSVGVQDQGIGIAENKKKSLFVRFENlVDSSLFNQS-SSGIGLSLVKELVEMHKASITVDSKLGEGSCF 1163
Cdd:PRK11006   349 GAEFSVEDNGPGIAPEHIPRLTERFYR-VDKARSRQTgGSGLGLAIVKHALSHHDSRLEIESEVGKGTRF 417
RpfG COG3437
Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains ...
1207-1364 5.86e-27

Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains [Signal transduction mechanisms];


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 113.99  E-value: 5.86e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1207 NKGEEGTENTDVRSTMLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELH 1285
Cdd:COG3437      2 RQSMQGKNEPDEKLTVLLVDDEPDNLEALRQLLRMIgYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEVLNKLK 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1286 -DNMTTSHIPMVLLTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERR------------KKLQEMYR--EKL 1350
Cdd:COG3437     82 aMSPSTRRIPVILLTAYADSEDRQRALEAGADDYLSKPISPKELVARVSSHLQLKrnedflldqnlyLELQELRRrtEEL 161
                          170
                   ....*....|....
gi 1119624474 1351 MNMATSPDEpTVEE 1364
Cdd:COG3437    162 AQIEDNLDE-TLEE 174
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
1220-1387 1.24e-26

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 109.34  E-value: 1.24e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1220 STMLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIPMVLL 1298
Cdd:TIGR02154    3 RRILVVEDEPAIRELIAYNLEKAgYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRRRPETRAIPIIML 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1299 TAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQEMYREKLMNMATSPDEPTVEESKAP-EMSPNDRKF 1377
Cdd:TIGR02154   83 TARGEEEDRVRGLETGADDYITKPFSPRELLARIKAVLRRIRPQLSDEVIEVGDLSLDPVAHRVFRGGQPlSLGPTEFRL 162
                          170
                   ....*....|
gi 1119624474 1378 MDKLMALMEK 1387
Cdd:TIGR02154  163 LHFFMTHPER 172
HATPase cd00075
Histidine kinase-like ATPase domain; This superfamily includes the histidine kinase-like ...
1064-1167 3.21e-26

Histidine kinase-like ATPase domain; This superfamily includes the histidine kinase-like ATPase (HATPase) domains of several ATP-binding proteins such as histidine kinase, DNA gyrase B, topoisomerases, heat shock protein 90 (HSP90), phytochrome-like ATPases and DNA mismatch repair proteins. Domains belonging to this superfamily are also referred to as GHKL (gyrase, heat-shock protein 90, histidine kinase, MutL) ATPase domains.


Pssm-ID: 340391 [Multi-domain]  Cd Length: 102  Bit Score: 103.84  E-value: 3.21e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1064 FEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSlfNQSSSGIGLSLVKEL 1143
Cdd:cd00075      1 LEQVLSNLLDNALKYSPPGGTIEISLRQEGDGVVLEVEDNGPGIPEEDLERIFERFYRGDKSR--EGGGTGLGLAIVRRI 78
                           90       100
                   ....*....|....*....|....
gi 1119624474 1144 VEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:cd00075     79 VEAHGGRITVESEPGGGTTFTVTL 102
CheY COG0784
CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];
1223-1340 6.07e-26

CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];


Pssm-ID: 223855 [Multi-domain]  Cd Length: 130  Bit Score: 104.16  E-value: 6.07e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANG-AEGLEKALSL-VPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLT 1299
Cdd:COG0784      9 LVVDDEPVNRRLLKRLLEDLgYEVVEAADGeEEALELLRELpQPDLILLDINMPGMDGIELLRRLRAR--GPNIPVILLT 86
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|..
gi 1119624474 1300 AKTAIESMLEGLEYGADDYITKP-FSATYLKARVRNILERRK 1340
Cdd:COG0784     87 AYADEADRERALAAGADDYLTKPiFLEEELLAALRRLLARAA 128
HK_VicK NF033093
cell wall metabolism sensor histidine kinase VicK; This model describes the protein VicK (or ...
951-1165 2.06e-25

cell wall metabolism sensor histidine kinase VicK; This model describes the protein VicK (or WalK) as found in Streptococcus pneumoniae, This protein is shorter than the WalK of Staphylococcus aureus, although apparently is functionally similar. Compare to model NF033092 (HK_WalK). VicK is a sensor histi


Pssm-ID: 333753 [Multi-domain]  Cd Length: 448  Bit Score: 111.35  E-value: 2.06e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  951 FFTDISHELRTPLTLITGPLEyVLQNTKLPAE-AREQLQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLEIVAFVR 1029
Cdd:NF033093   212 FVSNVSHELRTPLTSVKSYLE-ALDEGALSEPvAPSFIKVSLDETNRMMRMISDLLSLSRIDNQTSHLDVELTNFTAFIT 290
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1030 KIMDNFEAVAEEHHI-----DFVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQG 1104
Cdd:NF033093   291 FILNRFDQIKSQDTEtgkkyEIVRDYPITSIWVEIDTDKMTQVIDNILNNAIKYSPDGGKITVSMKTTDTQLIISISDEG 370
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1105 IGIAENKKKSLFVRFENLVDSSLFNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKV 1165
Cdd:NF033093   371 LGIPKKDLPLIFDRFYRVDKARSRAQGGTGLGLAIAKEIIKQHKGFIWAKSEYGKGSTFTI 431
PRK09303 PRK09303
adaptive-response sensory kinase; Validated
931-1163 3.37e-25

adaptive-response sensory kinase; Validated


Pssm-ID: 236462 [Multi-domain]  Cd Length: 380  Bit Score: 109.27  E-value: 3.37e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  931 IYRLKH-RVAMEQQLtHMKLRFFTDISHELRTPLT-----LITGPLEYVLQNTKLPAEAREQLQVVERNSNR-MLRLVNQ 1003
Cdd:PRK09303   134 LFVLRQeNETLLEQL-KFKDRVLAMLAHDLRTPLTaaslaLETLELGQIDEDTELKPALIEQLQDQARRQLEeIERLITD 212
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1004 ILDFRKIQNKKMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGK 1083
Cdd:PRK09303   213 LLEVGRTRWEALRFNPQKLDLGSLCQEVILELEKRWLAKSLEIQTDIPSDLPSVYADQERIRQVLLNLLDNAIKYTPEGG 292
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1084 MITVFV-HDNGQTVSVGVQDQGIGIAENKKKSLFvrfENLV----DSSlfnQSSSGIGLSLVKELVEMHKASITVDSKLG 1158
Cdd:PRK09303   293 TITLSMlHRTTQKVQVSICDTGPGIPEEEQERIF---EDRVrlprDEG---TEGYGIGLSVCRRIVRVHYGQIWVDSEPG 366

                   ....*
gi 1119624474 1159 EGSCF 1163
Cdd:PRK09303   367 QGSCF 371
YesN COG4753
Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding ...
1221-1479 4.50e-25

Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 227095 [Multi-domain]  Cd Length: 475  Bit Score: 110.53  E-value: 4.50e-25
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1221 TMLLVEDNTELRTFLRSIF---ASEFRVV-EAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIpmV 1296
Cdd:COG4753      3 KVLIVDDEPLIREGLKSLIdweALGIEVVgTAANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQSPDTEF--I 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1297 LLTAKTAIESMLEGLEYGADDYITKPFSATYLKA---RVRNILERRKK---LQEMYREKLMN---MATSPDEPTVEESKA 1367
Cdd:COG4753     81 ILSGYDEFEYAKKAMKLGVKDYLLKPVDKAELEEalkKIIGKLEEQQKvkqDIEKLLTLLIGhepLEELAKKIYKWEGAT 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1368 PEMSpNDRKFMDKL-------------MALMEKNLDNGDLIVDDLVKDMAVSRSVFFKKlksltglapvefikemRINRA 1434
Cdd:COG4753    161 GIQS-QLADSQRTLkdlaehlelspsyLSQLFKEEVGLFILERFLIRSAPFQEYGLLRK----------------RLEQA 223
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|..
gi 1119624474 1435 VQLIETGEYSM-------TQIAYMVGINDPRYFSKCFKQKMGMTPTEYRDRK 1479
Cdd:COG4753    224 KLLLVTSEQVSiyvlkvyREIAEKLGFEEADYFDYRFKKYLGMTPDQYNKQL 275
PRK11360 PRK11360
sensory histidine kinase AtoS; Provisional
933-1165 5.69e-24

sensory histidine kinase AtoS; Provisional


Pssm-ID: 236901 [Multi-domain]  Cd Length: 607  Bit Score: 108.52  E-value: 5.69e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  933 RLKHRVAMEQQLTHMKlRFFTDISHELRTPLTLITGPLEYVLQNTKLPaEAREQLQVVERNSNRMLRLVNQILDFrkiqN 1012
Cdd:PRK11360   376 RLQRRVARQERLAALG-ELVAGVAHEIRNPLTAIRGYVQIWRQQTSDP-PSQEYLSVVLREVDRLNKVIDQLLEF----S 449
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1013 KKMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDN 1092
Cdd:PRK11360   450 RPRESQWQPVSLNALVEEVLQLFQTAGVQARVDFETELDNELPPIWADPELLKQVLLNILINAVQAISARGKIRIRTWQY 529
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1119624474 1093 GQT-VSVGVQDQGIGIAENKKKSLFVRFenlvdsslFN--QSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKV 1165
Cdd:PRK11360   530 SDGqVAVSIEDNGCGIDPELLKKIFDPF--------FTtkAKGTGLGLALSQRIINAHGGDIEVESEPGVGTTFTL 597
HTH_ARAC smart00342
helix_turn_helix, arabinose operon control protein;
1396-1476 1.99e-23

helix_turn_helix, arabinose operon control protein;


Pssm-ID: 197666 [Multi-domain]  Cd Length: 84  Bit Score: 95.31  E-value: 1.99e-23
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  1396 VDDLVKDMAVSRSVFFKKLKSLTGLAPVEFIKEMRINRAVQLIETGEYSMTQIAYMVGINDPRYFSKCFKQKMGMTPTEY 1475
Cdd:smart00342    4 LEDLAEALGVSPRHLQRLFKKETGTTPKQYLRDRRLERARRLLRDTDLSVTEIALRVGFSSQSYFSRAFKKLFGVTPSEY 83

                    .
gi 1119624474  1476 R 1476
Cdd:smart00342   84 R 84
HATPase_EvgS-ArcB-TorS-like cd16922
Histidine kinase-like ATPase domain of two-component sensor histidine kinases, many are hybrid ...
1064-1168 2.95e-23

Histidine kinase-like ATPase domain of two-component sensor histidine kinases, many are hybrid sensor histidine kinases, similar to Escherichia coli EvgS, ArcB, TorS, BarA, RcsC; This family contains the histidine kinase-like ATPase (HATPase) domains of various two-component hybrid sensor histidine kinases (HKs), including the following Escherichia coli HKs: EvgS, a HK of the EvgS-EvgA two-component system (TCS) that confers acid resistance; ArcB, a HK of the ArcB-ArcA TCS that modulates the expression of numerous genes in response to respiratory growth conditions; TorS, a HK of the TorS-TorR TCS which is involved in the anaerobic utilization of trimethylamine-N-oxide; BarA, a HK of the BarA-UvrY TCS involved in the regulation of carbon metabolism; and RcsC, a HK of the RcsB-RcsC TCS which regulates the expression of the capsule operon and of the cell division gene ftsZ. Proteins having this HATPase domain also contain a histidine kinase dimerization and phosphoacceptor domain (HisKA), with most having accessory sensor domain(s) such as GAF, PAS and CHASE; many are hybrid sensor histidine kinases as they also contain a REC signal receiver domain.


Pssm-ID: 340399 [Multi-domain]  Cd Length: 110  Bit Score: 95.64  E-value: 2.95e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1064 FEKIVYNLLSNAFKYTPEGKmITVFVH-----DNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSLFNQSSSGIGLS 1138
Cdd:cd16922      1 LRQILLNLLGNAIKFTEEGE-VTLRVSleeeeEDGVQLRFSVEDTGIGIPEEQQARLFEPFSQADSSTTRKYGGTGLGLA 79
                           90       100       110
                   ....*....|....*....|....*....|
gi 1119624474 1139 LVKELVEMHKASITVDSKLGEGSCFKVDFQ 1168
Cdd:cd16922     80 ISKKLVELMGGDISVESEPGQGSTFTFTLP 109
PRK11100 PRK11100
sensory histidine kinase CreC; Provisional
957-1154 3.39e-23

sensory histidine kinase CreC; Provisional


Pssm-ID: 236846 [Multi-domain]  Cd Length: 475  Bit Score: 104.93  E-value: 3.39e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  957 HELRTPLTLITGPLEyVLQnTKLPAEAREQ-LQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLEIVAFVRKIMDNF 1035
Cdd:PRK11100   265 HELKSPLAAIRGAAE-LLQ-EDPPPEDRARfTGNILTQSARLQQLIDRLLELARLEQRQELEVLEPVALAALLEELVEAR 342
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1036 EAVAEEHHIDFVFETEKeavyLWVDADKF--EKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKK 1113
Cdd:PRK11100   343 EAQAAAKGITLRLRPDD----ARVLGDPFllRQALGNLLDNAIDFSPEGGTITLSAEVDGEQVALSVEDQGPGIPDYALP 418
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|...
gi 1119624474 1114 SLFVRFENLV--DSSlfnQSSSGIGLSLVKELVEMHKASITVD 1154
Cdd:PRK11100   419 RIFERFYSLPrpANG---RKSTGLGLAFVREVARLHGGEVTLR 458
HATPase_c pfam02518
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the ...
1060-1165 4.21e-23

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 334955 [Multi-domain]  Cd Length: 110  Bit Score: 95.14  E-value: 4.21e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1060 DADKFEKIVYNLLSNAFKYTPEGKmITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENlvDSSLFNQSSSGIGLSL 1139
Cdd:pfam02518    2 DELRLRQVLSNLLDNALKHAKAGE-ITVTLSADGGDLTLTVEDNGIGIPPEDLPRIFEPFST--DSSTRGGGGTGLGLSI 78
                           90       100
                   ....*....|....*....|....*.
gi 1119624474 1140 VKELVEMHKASITVDSKLGEGSCFKV 1165
Cdd:pfam02518   79 VRKLVELMGGTITVESEPGGGTTFTL 104
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
1197-1397 8.86e-23

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 103.17  E-value: 8.86e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1197 AVEDNGASEGNKGEEGTENTDVRST---MLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMM 1272
Cdd:COG3706    107 SIDELRLREETGGELGVSPLLPEDApkkILVVDDDATQRERLRRILQVEgFRVVEATDGEEALLQLAELPPDLVLLDANM 186
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1273 PEKDGLQMMRELHDNMTTSHIPMVLLTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILeRRKKLQEMYREKLmn 1352
Cdd:COG3706    187 PDMDGLELCTRLRQLERTRDIPIILLSSKDDDELVVRAFELGVNDYITKPIEEGELRARLRRQL-RRKRYERQLRESL-- 263
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1353 matspdEPTVEESKAPEMS--PNDRKFMDKLMALMEKNLDNGD----LIVD 1397
Cdd:COG3706    264 ------ERLQELALVDGLTglFNRRYFDEHLADLWKRALREGRplslLMLD 308
AtoC COG2204
DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, ...
1223-1349 7.16e-22

DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms];


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 100.46  E-value: 7.16e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTtsHIPMVLLTAK 1301
Cdd:COG2204      8 LVVDDDPDIRELLEQALELAgYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDP--DLPVIVMTGH 85
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 1119624474 1302 TAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQEMYREK 1349
Cdd:COG2204     86 GDIDTAVEALRLGAFDFLEKPFDLDRLLAIVERALELRELQRENRRSL 133
pleD PRK09581
response regulator PleD; Reviewed
1243-1342 9.70e-22

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 99.98  E-value: 9.70e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1243 FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIPMVLLTAKTAIESMLEGLEYGADDYITKP 1322
Cdd:PRK09581    27 YTVLTASSGAEAIAICEREQPDIILLDVMMPGMDGFEVCRRLKSDPATTHIPVVMVTALDDPEDRVRGLEAGADDFLTKP 106
                           90       100
                   ....*....|....*....|
gi 1119624474 1323 FSATYLKARVRNiLERRKKL 1342
Cdd:PRK09581   107 INDVALFARVKS-LTRLKMV 125
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
1220-1338 1.60e-21

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522 [Multi-domain]  Cd Length: 225  Bit Score: 94.49  E-value: 1.60e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1220 STMLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDnmtTSHIPMVLL 1298
Cdd:PRK10529     2 TNVLIVEDEQAIRRFLRTALEGDgMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQ---WSAIPVIVL 78
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|
gi 1119624474 1299 TAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK10529    79 SARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRR 118
HATPase_TutC-TodS-like cd16925
Histidine kinase-like ATPase domain of hybrid sensor histidine kinases similar to Pseudomonas ...
1060-1165 1.61e-21

Histidine kinase-like ATPase domain of hybrid sensor histidine kinases similar to Pseudomonas putida TodS and Thauera aromatica TutC; This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component hybrid sensor histidine kinase (HKs) such Pseudomonas putida TodS HK of the TodS-TodT two-component regulatory system (TCS) which controls the expression of a toluene degradation pathway. Thauera aromatica TutC may be part of a TCS that is involved in anaerobic toluene metabolism. Proteins having this HATPase domain also contain a histidine kinase dimerization and phosphoacceptor domain (HisKA), PAS sensor domain(s) and a REC domain.


Pssm-ID: 340402 [Multi-domain]  Cd Length: 110  Bit Score: 91.01  E-value: 1.61e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1060 DADKFEKIVYNLLSNAFKYTPEGKMITVFVH-DNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSLFNQSSSGIGLS 1138
Cdd:cd16925      1 DAEKYERVVLNLLSNAFKFTPDGGRIRCILEkFRLNRFLLTVSDSGPGIPPNLREEIFERFRQGDGSSTRAHGGTGLGLS 80
                           90       100
                   ....*....|....*....|....*..
gi 1119624474 1139 LVKELVEMHKASITVDSKLGEGSCFKV 1165
Cdd:cd16925     81 IVKEFVELHGGTVTVSDAPGGGALFQV 107
AraC COG2207
AraC-type DNA-binding domain and AraC-containing proteins [Transcription];
1378-1476 1.64e-21

AraC-type DNA-binding domain and AraC-containing proteins [Transcription];


Pssm-ID: 225117 [Multi-domain]  Cd Length: 127  Bit Score: 91.47  E-value: 1.64e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1378 MDKLMALMEKNLDNgDLIVDDLVKDMAVSRSVFFKKLKSLTGLAPVEFIKEMRINRAVQLIETGEYSMTQIAYMVGINDP 1457
Cdd:COG2207     22 LARALDYIEENLAE-PLTLEDLARRLGMSRRTLSRLFKKETGTSPSQYLRQLRLEEARRLLRSTDLSITEIALRLGYSSP 100
                           90
                   ....*....|....*....
gi 1119624474 1458 RYFSKCFKQKMGMTPTEYR 1476
Cdd:COG2207    101 SHFSRAFKRLFGVTPSEYR 119
PRK10841 PRK10841
hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional
937-1333 4.99e-21

hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional


Pssm-ID: 182772 [Multi-domain]  Cd Length: 924  Bit Score: 100.05  E-value: 4.99e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  937 RVAMEQQLTHM----------KLRFFTDISHELRTPLTLITGPLEyVLQNTKLPAEAREQLQVVERNSNRMLRLVNQILD 1006
Cdd:PRK10841   426 RVKMEESLQEMaqaaeqasqsKSMFLATVSHELRTPLYGIIGNLD-LLQTKELPKGVDRLVTAMNNSSSLLLKIISDILD 504
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1007 FRKIQNKKMKMQVQRLEIVAFVRKIMDNFEA-VAEEHHIDFVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGkMI 1085
Cdd:PRK10841   505 FSKIESEQLKIEPREFSPREVINHITANYLPlVVKKRLGLYCFIEPDVPVALNGDPMRLQQVISNLLSNAIKFTDTG-CI 583
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1086 TVFVHDNGQTVSVGVQDQGIGIAEnkkKSLFVRFENLVDSSLFNQSSS---GIGLSLVKELVEMHKASITVDSKLGEGSC 1162
Cdd:PRK10841   584 VLHVRVDGDYLSFRVRDTGVGIPA---KEVVRLFDPFFQVGTGVQRNFqgtGLGLAICEKLINMMDGDISVDSEPGMGSQ 660
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1163 FKV-------DFQKGKEHYDET-------------VEFLQ--------------------NDV----------------- 1185
Cdd:PRK10841   661 FTIriplygaQYPQKKGVEGLQgkrcwlavrnaslEQFLEtllqrsgiqvqryegqeptpEDVlitddpvqkkwqgravi 740
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1186 ----EQGGAKQEQQT-------------------------AVEDNGASEGNKGEEGTENTDVRstMLLVEDNTELRTFLR 1236
Cdd:PRK10841   741 tfcrRHIGIPLEIAPgewvhstatphelpallariyrielESDDSANALPSTDKAVSDNDDMM--ILVVDDHPINRRLLA 818
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1237 SIFAS-EFRVVEAANGAEGLEkALSLVP-DIIISDVMMPEKDGL---QMMRELhdNMTtshIPMVLLTAKTAIESMLEGL 1311
Cdd:PRK10841   819 DQLGSlGYQCKTANDGVDALN-VLSKNHiDIVLTDVNMPNMDGYrltQRLRQL--GLT---LPVIGVTANALAEEKQRCL 892
                          490       500
                   ....*....|....*....|....*....
gi 1119624474 1312 EYGADDYITKPFSATYLK-------ARVR 1333
Cdd:PRK10841   893 EAGMDSCLSKPVTLDVLKqtltvyaERVR 921
PRK11173 PRK11173
two-component response regulator; Provisional
1223-1365 5.06e-21

two-component response regulator; Provisional


Pssm-ID: 183013 [Multi-domain]  Cd Length: 237  Bit Score: 93.54  E-value: 5.06e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEgLEKALSLVP-DIIISDVMMPEKDGLQMMRELHDNmttSHIPMVLLTA 1300
Cdd:PRK11173     7 LIVEDELVTRNTLKSIFEAEgYDVFEATDGAE-MHQILSENDiNLVIMDINLPGKNGLLLARELREQ---ANVALMFLTG 82
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1119624474 1301 K-TAIESMLeGLEYGADDYITKPFSATYLKARVRNILERrkklqemyrekLMNMATSPDEPTVEES 1365
Cdd:PRK11173    83 RdNEVDKIL-GLEIGADDYITKPFNPRELTIRARNLLSR-----------TMNLGTVSEERRSVES 136
PRK10955 PRK10955
DNA-binding transcriptional regulator CpxR; Provisional
1222-1338 8.45e-21

DNA-binding transcriptional regulator CpxR; Provisional


Pssm-ID: 182864 [Multi-domain]  Cd Length: 232  Bit Score: 92.94  E-value: 8.45e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFASE-FRVVEAANGaeglEKALSLVP---DIIISDVMMPEKDGLQMMRELHDNMTTshiPMVL 1297
Cdd:PRK10955     4 ILLVDDDRELTSLLKELLEMEgFNVIVAHDG----EQALDLLDdsiDLLLLDVMMPKKNGIDTLKELRQTHQT---PVIM 76
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|.
gi 1119624474 1298 LTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK10955    77 LTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRR 117
COG4251 COG4251
Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal ...
937-1163 1.70e-20

Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms];


Pssm-ID: 226702 [Multi-domain]  Cd Length: 750  Bit Score: 97.89  E-value: 1.70e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  937 RVAMEQQLTHMKLRFFTDI-SHELRTPLTLITGPLEYVLQNT--KLPAEAREQLQVVERNSNRMLRLVNQILDFRKIQNK 1013
Cdd:COG4251    512 QLRRELERSNAELRAFAYVaSHDLQEPLRQISNYAQLLSERYsdALDEEAKEFITFISRLTSLMQQLIDDLLTYSKLGLT 591
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1014 KMKMQVQRLEIVafVRKIMDNFEAVAEEHHIDFVFETEKEAVylwVDADKFEKIVYNLLSNAFKY-TPEGKMITVFVHDN 1092
Cdd:COG4251    592 EAPLQPTDVQKV--VDKVLLELSQRIADTGAEIRIAPLPVVA---ADATQLGQVFQNLIANAIKFgGPENPDIEISAERQ 666
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1093 GQTVSVGVQDQGIGIAENKKKSLFVRFENLvdSSLFNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCF 1163
Cdd:COG4251    667 EDEWTFSVRDNGIGIDPAYFERIFVIFQRL--HSRDEYLGTGLGLAICKKIAERHQGRIWVESTPGEGSTF 735
orf27 CHL00148
Ycf27; Reviewed
1222-1341 2.83e-20

Ycf27; Reviewed


Pssm-ID: 214376 [Multi-domain]  Cd Length: 240  Bit Score: 91.32  E-value: 2.83e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFA-SEFRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHdnmTTSHIPMVLLTA 1300
Cdd:CHL00148     9 ILVVDDEAYIRKILETRLSiIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDGYGVCQEIR---KESDVPIIMLTA 85
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|.
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKK 1341
Cdd:CHL00148    86 LGDVSDRITGLELGADDYVVKPFSPKELEARIRSVLRRTNK 126
Y_Y_Y pfam07495
Y_Y_Y domain; This domain is mostly found at the end of the beta propellers (pfam07494) in a ...
836-900 3.97e-20

Y_Y_Y domain; This domain is mostly found at the end of the beta propellers (pfam07494) in a family of two component regulators. However they are also found tandemly repeated in CTC_02402 without other signal conduction domains being present. It's named after the conserved tyrosines found in the alignment. The exact function is not known.


Pssm-ID: 284830  Cd Length: 65  Bit Score: 85.10  E-value: 3.97e-20
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1119624474  836 DYTNPSDIQYAYMLDGFEKNWNYVGKQRTATYTNLPKGHYVFKVRSTNADGVWSDNVRTLDIEVL 900
Cdd:pfam07495    1 NYDGPENLLYRYRLEGFDGEWVELGDYSEASYTNLPPGKYTLKVKAKDKDGNWSYDDASLNFTIL 65
ompR PRK09468
osmolarity response regulator; Provisional
1215-1339 4.30e-20

osmolarity response regulator; Provisional


Pssm-ID: 181883 [Multi-domain]  Cd Length: 239  Bit Score: 90.80  E-value: 4.30e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1215 NTDVRSTMLLVEDNTELRTFLRSIFASE-FRVVEAANgAEGLEKALSL-VPDIIISDVMMPEKDGLQMMRELHDNmtTSH 1292
Cdd:PRK09468     1 MMQENYKILVVDDDMRLRALLERYLTEQgFQVRSAAN-AEQMDRLLTReSFHLMVLDLMLPGEDGLSICRRLRSQ--NNP 77
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*..
gi 1119624474 1293 IPMVLLTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERR 1339
Cdd:PRK09468    78 TPIIMLTAKGEEVDRIVGLEIGADDYLPKPFNPRELLARIRAVLRRQ 124
PRK10710 PRK10710
DNA-binding transcriptional regulator BaeR; Provisional
1215-1344 6.55e-20

DNA-binding transcriptional regulator BaeR; Provisional


Pssm-ID: 182665 [Multi-domain]  Cd Length: 240  Bit Score: 90.51  E-value: 6.55e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1215 NTDVRSTMLLVEDNTELRTFLRSIF-ASEFRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHdnmTTSHI 1293
Cdd:PRK10710     6 IDENTPRILIVEDEPKLGQLLIDYLqAASYATTLLSHGDEVLPYVRQTPPDLILLDLMLPGTDGLTLCREIR---RFSDI 82
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1294 PMVLLTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQE 1344
Cdd:PRK10710    83 PIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCKPQRE 133
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
1222-1387 3.19e-19

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277 [Multi-domain]  Cd Length: 229  Bit Score: 88.24  E-value: 3.19e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIPMVLLTA 1300
Cdd:PRK10161     5 ILVVEDEAPIREMVCFVLEQNgFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTA 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERrkkLQEMYREKLMNMATSPDEPT---VEESKAP-EMSPNDRK 1376
Cdd:PRK10161    85 RGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---ISPMAVEEVIEMQGLSLDPTshrVMAGEEPlEMGPTEFK 161
                          170
                   ....*....|.
gi 1119624474 1377 FMDKLMALMEK 1387
Cdd:PRK10161   162 LLHFFMTHPER 172
HTH_18 pfam12833
Helix-turn-helix domain;
1399-1478 3.91e-19

Helix-turn-helix domain;


Pssm-ID: 338511 [Multi-domain]  Cd Length: 81  Bit Score: 83.02  E-value: 3.91e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1399 LVKDMAVSRSVFFKKLKSLTGLAPVEFIKEMRINRAVQ-LIETGEYSMTQIAYMVGINDPRYFSKCFKQKMGMTPTEYRD 1477
Cdd:pfam12833    1 LAAALGVSPRTLSRLFKRETGLSPKEYLRRLRLERARRlLLEDTGLSVAEIALALGFSSASHFSRAFKRHFGETPSEYRR 80

                   .
gi 1119624474 1478 R 1478
Cdd:pfam12833   81 R 81
PRK11517 PRK11517
transcriptional regulatory protein YedW; Provisional
1222-1338 7.60e-19

transcriptional regulatory protein YedW; Provisional


Pssm-ID: 183172 [Multi-domain]  Cd Length: 223  Bit Score: 86.88  E-value: 7.60e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFASEFRVVEAA-NGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHdnmTTSHIPMVLLTA 1300
Cdd:PRK11517     3 ILLIEDNQRTQEWVTQGLSEAGYVIDAVsDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLR---TAKQTPVICLTA 79
                           90       100       110
                   ....*....|....*....|....*....|....*...
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK11517    80 RDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQ 117
cztR_silR_copR TIGR01387
heavy metal response regulator; Members of this family contain a response regulator receiver ...
1222-1338 1.21e-18

heavy metal response regulator; Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions]


Pssm-ID: 130454 [Multi-domain]  Cd Length: 218  Bit Score: 86.01  E-value: 1.21e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFASEFRVVEAA-NGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTShiPMVLLTA 1300
Cdd:TIGR01387    1 ILVVEDEQKTAEYLQQGLSESGYVVDAAsNGRDGLHLALKDDYDLIILDVMLPGMDGWQILQTLRRSGKQT--PVLFLTA 78
                           90       100       110
                   ....*....|....*....|....*....|....*...
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:TIGR01387   79 RDSVADKVKGLDLGADDYLVKPFSFSELLARVRTLLRR 116
PRK10766 PRK10766
DNA-binding transcriptional regulator TorR; Provisional
1221-1338 1.41e-18

DNA-binding transcriptional regulator TorR; Provisional


Pssm-ID: 182711 [Multi-domain]  Cd Length: 221  Bit Score: 85.86  E-value: 1.41e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1221 TMLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHdnmTTSHIPMVLLT 1299
Cdd:PRK10766     4 HILVVEDEPVTRARLQGYFEQEgYTVSEAASGAGMREIMQNQHVDLILLDINLPGEDGLMLTRELR---SRSTVGIILVT 80
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|
gi 1119624474 1300 AKT-AIESMLeGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK10766    81 GRTdSIDRIV-GLEMGADDYVTKPLELRELLVRVKNLLWR 119
PRK10490 PRK10490
sensor protein KdpD; Provisional
955-1165 5.06e-18

sensor protein KdpD; Provisional


Pssm-ID: 236701 [Multi-domain]  Cd Length: 895  Bit Score: 90.10  E-value: 5.06e-18
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  955 ISHELRTPLTLITGPLEYVLQNtkLPAEAREQLQVVERNSNRML---RLVNQILDFRKIQNK--KMKMQVQRL-EIVAFV 1028
Cdd:PRK10490   671 LSHDLRTPLTVLFGQAEILTLD--LASEGSPHARQASEIRQQVLnttRLVNNLLDMARIQSGgfNLRKEWLTLeEVVGSA 748
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1029 RKIMDNFEAvaeEHHIDFvfETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIA 1108
Cdd:PRK10490   749 LQMLEPGLS---GHPINL--SLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAHVEGERLQLDVWDNGPGIP 823
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1109 ENKKKSLFVRFenlvdsSLFNQSSS----GIGLSLVKELVEMHKASITVDSKLGEGSCFKV 1165
Cdd:PRK10490   824 PGQEQLIFDKF------ARGNKESAipgvGLGLAICRAIVEVHGGTIWAENRPEGGACFRV 878
HisKA smart00388
His Kinase A (phosphoacceptor) domain; Dimerisation and phosphoacceptor domain of histidine ...
947-1012 5.10e-18

His Kinase A (phosphoacceptor) domain; Dimerisation and phosphoacceptor domain of histidine kinases.


Pssm-ID: 214644 [Multi-domain]  Cd Length: 66  Bit Score: 79.15  E-value: 5.10e-18
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1119624474   947 MKLRFFTDISHELRTPLTLITGPLEyVLQNTKLPAEAREQLQVVERNSNRMLRLVNQILDFRKIQN 1012
Cdd:smart00388    1 AKREFLANLSHELRTPLTAIRGYLE-LLLDTELSEEQREYLETILREAERLLRLINDLLDLSRIEA 65
CitB COG2197
DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal ...
1223-1361 2.40e-17

DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 225107 [Multi-domain]  Cd Length: 211  Bit Score: 81.97  E-value: 2.40e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASEFR---VVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMttSHIPMVLLT 1299
Cdd:COG2197      4 LIVDDHPLVREGLRQLLELEPDlevVGEASNGEEALDLARELKPDVVLLDLSMPGMDGLEALKQLRARG--PDIKVVVLT 81
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1119624474 1300 AKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQEMYREKLMNMATSPDEPT 1361
Cdd:COG2197     82 AHDDPAYVIRALRAGADGYLLKDASPEELVEAIRAVAAGGTYLPPDIARKLAGLLPSSSAEA 143
COG3292 COG3292
Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];
414-793 4.99e-17

Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];


Pssm-ID: 225829 [Multi-domain]  Cd Length: 671  Bit Score: 86.48  E-value: 4.99e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  414 DRQGNLWMcTHSKGLEKVTFRT------DRFRLKVPVNHSYEslsnevralceDKDGNMWVGLKDGmlrvynrhreeIGY 487
Cdd:COG3292    173 DANGRLWV-GTPDGLSYFDAGRgkalqlASPPLDKAINALIA-----------DVQGRLWVGTDQG-----------VYL 229
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  488 LTEAGTVSHSGKPLF--GNTYFVMQDSHDNLWIATKGAGVVKAEPLPGtLRYRL--TRYRYSAddvyslsddnVYCLYED 563
Cdd:COG3292    230 QEAEGWRASNWGPMLpsGNILLLVQDAQGELWIGTENGLWRTRLPRQG-LQIPLskMHLGVST----------VNSLWLD 298
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  564 RRGRIWVATFANGISYLTRNADGKEVFishrNNLKGFPIKYCskvRCITGDADGHIWIGTTVGLLMVDDGFDRpEDARFY 643
Cdd:COG3292    299 TDGSLWVGTYGGIVRYLTADWKRMAVI----NDSDGGVSQYE---AVAPALLSWGVRQLNSIGELMVANGSTG-ELVRSV 370
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  644 HYLRApekanalsnNDIHWVKPTREGELYVATFGGGLNQLvDLNAEGqarfKAYTVRDGLPSDILLSIQEDKKGQLWIST 723
Cdd:COG3292    371 HQLRG---------MNITTTLEDSRGRLWLGSMQNGLSRL-DNKNEW----AVLDEDAGLPSSEVSAIVEDPDNSLWIGT 436
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1119624474  724 ENGLSKFTPGLGRFEN---FQNKYSNSSIrfsEAASAYASDGNILFGTNHGIFYFnpdSIQKSVYVPPIVLTQ 793
Cdd:COG3292    437 SGGLVKRDPESGRVLNllnPGSHGLDGSR---VEQLGLGPDGRLWLAAGSGVAAW---ESQRRMFVPILDLTG 503
PRK09836 PRK09836
DNA-binding transcriptional activator CusR; Provisional
1222-1338 1.02e-16

DNA-binding transcriptional activator CusR; Provisional


Pssm-ID: 182102 [Multi-domain]  Cd Length: 227  Bit Score: 80.74  E-value: 1.02e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFL-RSIFASEFRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDnmTTSHIPMVLLTA 1300
Cdd:PRK09836     3 LLIVEDEKKTGEYLtKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRS--ANKGMPILLLTA 80
                           90       100       110
                   ....*....|....*....|....*....|....*...
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK09836    81 LGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRR 118
PRK10364 PRK10364
sensor protein ZraS; Provisional
910-1166 1.50e-16

sensor protein ZraS; Provisional


Pssm-ID: 236674 [Multi-domain]  Cd Length: 457  Bit Score: 84.07  E-value: 1.50e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  910 YFLYVLFFLLIIVTAVYILFTIYRlKHRVAMEQQLTHMKLR--------FFTDISHELRTPLTLITGPLEYVLQNTKLPA 981
Cdd:PRK10364   192 NTLIILFALATVLLASLLAFFWYR-RYLRSRQLLQDEMKRKeklvalghLAAGVAHEIRNPLSSIKGLAKYFAERAPAGG 270
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  982 EAREQLQVVERNSNRMLRLVNQILDFrkiqNKKMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVYLWVDA 1061
Cdd:PRK10364   271 EAHQLAQVMAKEADRLNRVVSELLEL----VKPTHLALQAVDLNDLINHSLQLVSQDANSREIQLRFTANDTLPEIQADP 346
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1062 DKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFenlvdsslFNQSS--SGIGLSL 1139
Cdd:PRK10364   347 DRLTQVLLNLYLNAIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLEAIFTPY--------FTTKAegTGLGLAV 418
                          250       260
                   ....*....|....*....|....*..
gi 1119624474 1140 VKELVEMHKASITVDSKLGEGSCFKVD 1166
Cdd:PRK10364   419 VHNIVEQHGGTIQVASQEGKGATFTLW 445
HATPase_BasS-like cd16940
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1051-1160 1.77e-16

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli BasS; This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component sensor histidine kinase (HKs) similar to Escherichia coli BasS HK of the BasS-BasR two-component regulatory system (TCS). Proteins having this HATPase domain also contain a histidine kinase dimerization and phosphoacceptor domain (HisKA); some contain a HAMP sensory domain, while some an N-terminal two-component sensor kinase domain.


Pssm-ID: 340417 [Multi-domain]  Cd Length: 113  Bit Score: 76.68  E-value: 1.77e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1051 EKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVhDNGQTVSVGVQDQGIGIAENKKKSLFVRFenlVDSSLFNQ 1130
Cdd:cd16940      1 SAADIQVQGDALLLFLLLRNLVDNAVRYSPQGSRVEIKL-SADDGAVIRVEDNGPGIDEEELEALFERF---YRSDGQNY 76
                           90       100       110
                   ....*....|....*....|....*....|
gi 1119624474 1131 SSSGIGLSLVKELVEMHKASITVDSKLGEG 1160
Cdd:cd16940     77 GGSGLGLSIVKRIVELHGGQIFLGNAQGGG 106
GlxA COG4977
Transcriptional regulator GlxA family, contains an amidase domain and an AraC-type DNA-binding ...
1380-1482 2.37e-16

Transcriptional regulator GlxA family, contains an amidase domain and an AraC-type DNA-binding HTH domain [Transcription];


Pssm-ID: 227311 [Multi-domain]  Cd Length: 328  Bit Score: 81.94  E-value: 2.37e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1380 KLMALMEKNLDnGDLIVDDLVKDMAVSRSVFFKKLKSLTGLAPVEFIKEMRINRAVQLIETGEYSMTQIAYMVGINDPRY 1459
Cdd:COG4977    224 RAIELMEANLE-EPLSLEELADRAGLSRRQLERLFRAELGVSPARYYLRLRLERARRLLEQTRLSIAEIAVACGFSSASH 302
                           90       100
                   ....*....|....*....|...
gi 1119624474 1460 FSKCFKQKMGMTPTEYRDRKAGK 1482
Cdd:COG4977    303 FSRAFRRQFGLSPSEYRRRFRSR 325
HisKA cd00082
Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed ...
947-1009 4.98e-16

Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase. They subsequently transfer the phosphoryl group to the Asp acceptor residue of a response regulator protein. Two-component signalling systems, consisting of a histidine protein kinase that senses a signal input and a response regulator that mediates the output, are ancient and evolutionarily conserved signaling mechanisms in prokaryotes and eukaryotes.


Pssm-ID: 119399 [Multi-domain]  Cd Length: 65  Bit Score: 73.40  E-value: 4.98e-16
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1119624474  947 MKLRFFTDISHELRTPLTLITGPLEYVLQNTKLPAEAREQLQVVERNSNRMLRLVNQILDFRK 1009
Cdd:cd00082      3 AKGEFLANVSHELRTPLTAIRGALELLEEELLDDEEQREYLERIREEAERLLRLINDLLDLSR 65
PRK11107 PRK11107
hybrid sensory histidine kinase BarA; Provisional
948-1163 5.42e-16

hybrid sensory histidine kinase BarA; Provisional


Pssm-ID: 236848 [Multi-domain]  Cd Length: 919  Bit Score: 83.75  E-value: 5.42e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  948 KLRFFTDISHELRTPLTLITGPLEYVLQnTKLPAEAREQLQVVERNSNRMLRLVNQILDFRKIQNKKMKmqvqrLEIVAF 1027
Cdd:PRK11107   293 KSEFLANMSHELRTPLNGVIGFTRQTLK-TPLTPTQRDYLQTIERSANNLLAIINDILDFSKLEAGKLV-----LENIPF 366
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1028 -VRKIMDnfEAV------AEEHHIDFVFETEKEAVYLWV-DADKFEKIVYNLLSNAFKYTPEGkMITVFVH-----DNGQ 1094
Cdd:PRK11107   367 sLRETLD--EVVtllahsAHEKGLELTLNIDPDVPDNVIgDPLRLQQIITNLVGNAIKFTESG-NIDILVElralsNTKV 443
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1119624474 1095 TVSVGVQDQGIGIAENKKKSLFVRFeNLVDSSLfnqssS----GIGLSLV--KELVEMHKASITVDSKLGEGSCF 1163
Cdd:PRK11107   444 QLEVQIRDTGIGISERQQSQLFQAF-RQADASI-----SrrhgGTGLGLVitQKLVNEMGGDISFHSQPNRGSTF 512
HisKA pfam00512
His Kinase A (phospho-acceptor) domain; dimerization and phospho-acceptor domain of histidine ...
947-1012 5.57e-16

His Kinase A (phospho-acceptor) domain; dimerization and phospho-acceptor domain of histidine kinases.


Pssm-ID: 334120 [Multi-domain]  Cd Length: 63  Bit Score: 73.36  E-value: 5.57e-16
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1119624474  947 MKLRFFTDISHELRTPLTLITGPLEyVLQntKLPAEAREQLQVVERNSNRMLRLVNQILDFRKIQN 1012
Cdd:pfam00512    1 AKREFLANLSHELRTPLTAIRGYLE-LLR--DLPEEQREYLETILRSAERLLRLINDLLDLSRIEA 63
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
1222-1339 8.12e-16

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612 [Multi-domain]  Cd Length: 222  Bit Score: 78.15  E-value: 8.12e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFASEFRVVE-AANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTshIPMVLLTA 1300
Cdd:PRK10643     3 ILIVEDDTLLLQGLILALQTEGYACDcASTAREAEALLESGHYSLVVLDLGLPDEDGLHLLRRWRQKKYT--LPVLILTA 80
                           90       100       110
                   ....*....|....*....|....*....|....*....
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERR 1339
Cdd:PRK10643    81 RDTLEDRVAGLDVGADDYLVKPFALEELHARIRALIRRH 119
PRK11466 PRK11466
hybrid sensory histidine kinase TorS; Provisional
934-1284 9.15e-16

hybrid sensory histidine kinase TorS; Provisional


Pssm-ID: 236914 [Multi-domain]  Cd Length: 914  Bit Score: 83.03  E-value: 9.15e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  934 LKHRVAMEQ--QLTHMKLRFFTDISHELRTPLTLITGPLEYVLQNTKLPAEaREQLQVVERNSNRMLRLVNQILDFRKIQ 1011
Cdd:PRK11466   428 IEHRQARAEaeKASQAKSAFLAAMSHEIRTPLYGILGTAQLLADNPALNAQ-RDDLRAITDSGESLLTILNDILDYSAIE 506
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1012 --NKKMKMQVQRLEIVAFVRKIMDNFEAVAEEHHIDFVFETeKEAVYLWVDAD--KFEKIVYNLLSNAFKYTPEGkMITV 1087
Cdd:PRK11466   507 agGKNVSVSDEPFEPRPLLESTLQLMSGRVKGRPIRLATDI-ADDLPTALMGDprRIRQVITNLLSNALRFTDEG-SIVL 584
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1088 FVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDsslfNQSSSGIGLSLVKELVEMHKASITVDSKLGEGSCFKVdf 1167
Cdd:PRK11466   585 RSRTDGEQWLVEVEDSGCGIDPAKLAEIFQPFVQVSG----KRGGTGLGLTISSRLAQAMGGELSATSTPEVGSCFCL-- 658
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1168 qkgkehydetveflqndveqggakqeqQTAVEDNGASEGNKGEEGTENTDVRstMLLVEDNT-ELRTFLRSIFASEFRVV 1246
Cdd:PRK11466   659 ---------------------------RLPLRVATAPVPKTVNQAVRLDGLR--LLLIEDNPlTQRITAEMLNTSGAQVV 709
                          330       340       350
                   ....*....|....*....|....*....|....*....
gi 1119624474 1247 EAANGAEGLEK-ALSLVPDIIISDVMMPEKDGLQMMREL 1284
Cdd:PRK11466   710 AVGNAAQALETlQNSEPFAAALVDFDLPDYDGITLARQL 748
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
1219-1345 1.25e-15

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 81.05  E-value: 1.25e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1219 RSTMLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTShiPMVL 1297
Cdd:PRK11361     4 INRILIVDDEDNVRRMLSTAFALQgFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRT--PVIL 81
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 1119624474 1298 LTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQEM 1345
Cdd:PRK11361    82 MTAYAEVETAVEALRCGAFDYVIKPFDLDELNLIVQRALQLQSMKKEI 129
PRK11083 PRK11083
DNA-binding response regulator CreB; Provisional
1221-1341 1.84e-15

DNA-binding response regulator CreB; Provisional


Pssm-ID: 236838 [Multi-domain]  Cd Length: 228  Bit Score: 76.92  E-value: 1.84e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1221 TMLLVEDNTELRTFLrsIFA--SE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVL 1297
Cdd:PRK11083     5 TILLVEDEQAIADTL--VYAlqSEgFTVEWFERGLPALDKLRQQPPDLVILDVGLPDISGFELCRQLLAF--HPALPVIF 80
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....
gi 1119624474 1298 LTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKK 1341
Cdd:PRK11083    81 LTARSDEVDRLVGLEIGADDYVAKPFSPREVAARVRTILRRVKK 124
HATPase_YcbM-like cd16947
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1055-1165 2.10e-15

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Bacillus subtilis YcbM; This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component sensor histidine kinase (HKs) such as Bacillus subtilis YcbM, a HK of the two-component system YcbM-YcbL. Proteins having this HATPase domain also contain a histidine kinase dimerization and phosphoacceptor domain (HisKA).


Pssm-ID: 340423 [Multi-domain]  Cd Length: 125  Bit Score: 74.09  E-value: 2.10e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1055 VYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSLFNQSSSG 1134
Cdd:cd16947     12 IYANANTEALQRILKNLISNAIKYGSDGKFLGMTLREDEKHVYIDIWDKGKGISETEKDHVFERLYTLEDSRNSAKQGNG 91
                           90       100       110
                   ....*....|....*....|....*....|.
gi 1119624474 1135 IGLSLVKELVEMHKASITVDSKLGEGSCFKV 1165
Cdd:cd16947     92 LGLTITKRLAESMGGSIYVNSKPYEKTVFTV 122
HATPase_FilI-like cd16921
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1070-1163 2.10e-15

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Methanosaeta harundinacea FilI and some hybrid sensor histidine kinases; This family includes FilI, the histidine kinase (HK) component of FilI-FilRs, a two-component signal transduction system (TCS) of the methanogenic archaeon, Methanosaeta harundinacea, which is involved in regulating methanogenesis. The cytoplasmic HK core consists of a C-terminal HK-like ATPase domain (represented here) and a histidine kinase dimerization and phosphoacceptor domain (HisKA) domain, which, in FilI, are coupled to CHASE, HAMP, PAS, and GAF sensor domains. FilI-FilRs catalyzes the phosphotransfer between FilI (HK) and FilRs (FilR1 and FilR2, response regulators) of the TCS. TCSs are predicted to be of bacterial origin, and acquired by archaea by horizontal gene transfer. This model also includes related HATPase domains such as that of Synechocystis sp. PCC6803 phytochrome-like protein Cph1. Proteins having this HATPase domain and HisKA domain also have accessory sensor domains such as CHASE, GAF, HAMP and PAS; some are hybrid sensor histidine kinases as they also contain a REC signal receiver domain.


Pssm-ID: 340398 [Multi-domain]  Cd Length: 105  Bit Score: 73.13  E-value: 2.10e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1070 NLLSNAFKYTPEG--KMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSLFnqSSSGIGLSLVKELVEMH 1147
Cdd:cd16921      7 NLLGNAIKFRRPRrpPRIEVGAEDVGEEWTFYVRDNGIGIDPEYAEKVFGIFQRLHSREEY--EGTGVGLAIVRKIIERH 84
                           90
                   ....*....|....*.
gi 1119624474 1148 KASITVDSKLGEGSCF 1163
Cdd:cd16921     85 GGRIWLESEPGEGTTF 100
PRK10651 PRK10651
transcriptional regulator NarL; Provisional
1215-1321 2.95e-15

transcriptional regulator NarL; Provisional


Pssm-ID: 182619 [Multi-domain]  Cd Length: 216  Bit Score: 76.22  E-value: 2.95e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1215 NTDVRSTMLLVEDNTELRTFLRSI--FASEFRVV-EAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTS 1291
Cdd:PRK10651     2 SNQEPATILLIDDHPMLRTGVKQLisMAPDITVVgEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSG 81
                           90       100       110
                   ....*....|....*....|....*....|
gi 1119624474 1292 HIpmVLLTAKTAIESMLEGLEYGADDYITK 1321
Cdd:PRK10651    82 RI--VVFSVSNHEEDVVTALKRGADGYLLK 109
AdaA COG2169
Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), ...
1380-1482 4.27e-15

Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains [Replication, recombination and repair];


Pssm-ID: 225080 [Multi-domain]  Cd Length: 187  Bit Score: 75.08  E-value: 4.27e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1380 KLMALMEKNLDNGDLivDDLVKDMAVSRSVFFKKLKSLTGLAPVEFIKEMRINRAVQLIETGEySMTQIAYMVGINDPRY 1459
Cdd:COG2169     86 TACRLIEQNPEKRWL--EELADELGVSPSTLHRLFKAITGMTPKEYARARRMGRARKQLRMGA-SVTDAQIDAGFESSSR 162
                           90       100
                   ....*....|....*....|...
gi 1119624474 1460 FSKCFKQKMGMTPTEYRDRKAGK 1482
Cdd:COG2169    163 FYDAFSKILGMTPTKFRHGGILK 185
PRK15479 PRK15479
transcriptional regulatory protein TctD; Provisional
1222-1338 7.19e-15

transcriptional regulatory protein TctD; Provisional


Pssm-ID: 185376 [Multi-domain]  Cd Length: 221  Bit Score: 75.14  E-value: 7.19e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFASE-FRVVEAANG--AEGLEKALSLVpdIIISDVMMPEKDGLQMMRELHDNMTTshIPMVLL 1298
Cdd:PRK15479     3 LLLAEDNRELAHWLEKALVQNgFAVDCVFDGlaADHLLQSEMYA--LAVLDINMPGMDGLEVLQRLRKRGQT--LPVLLL 78
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|
gi 1119624474 1299 TAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK15479    79 TARSAVADRVKGLNVGADDYLPKPFELEELDARLRALLRR 118
HATPase_DpiB-CitA-like cd16915
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1067-1165 1.93e-14

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli K-12 DpiB, DcuS, and Bacillus subtilis CitS, DctS, and YufL; This family includes histidine kinase-like ATPase domains of Escherichia coli K-12 DpiB and DcuS, and Bacillus subtilis CitS, DctS and MalK histidine kinases (HKs) all of which are two component transduction systems (TCSs). E. coli K-12 DpiB (also known as CitA) is the histidine kinase (HK) of DpiA-DpiB, a two-component signal transduction system (TCS) required for the expression of citrate-specific fermentation genes and genes involved in plasmid inheritance. E. coli K-12 DcuS (also known as YjdH) is the HK of DcuS-DcuR, a TCS that in the presence of the extracellular C4-dicarboxlates, activates the expression of the genes of anaerobic fumarate respiration and of aerobic C4-dicarboxylate uptake. CitS is the HK of Bacillus subtilis CitS-CitT, a TCS which regulates expression of CitM, the Mg-citrate transporter. Bacillus subtilis DctS forms a tripartite sensor unit (DctS/DctA/DctB) for sensing C4 dicarboxylates. Bacillus subtilis MalK (also known as YfuL) is the HK of MalK-MalR (YufL-YufM) a TCS which regulates the expression of the malate transporters MaeN (YufR) and YflS, and is essential for utilization of malate in minimal medium. Proteins having this DpiB-CitA-like HATPase domain generally have sensor domains such as Cache and PAS, and a histidine kinase A (HisKA)-like SpoOB-type, alpha-helical domain.


Pssm-ID: 340392 [Multi-domain]  Cd Length: 104  Bit Score: 70.39  E-value: 1.93e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1067 IVYNLLSNAFKYT----PEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRfenlvDSSLFNQSSSGIGLSLVKE 1142
Cdd:cd16915      4 IVGNLIDNALDALaatgAPNKQVEVFLRDEGDDLVIEVRDTGPGIAPELRDKVFER-----GVSTKGQGERGIGLALVRQ 78
                           90       100
                   ....*....|....*....|...
gi 1119624474 1143 LVEMHKASITVDSKLGEGSCFKV 1165
Cdd:cd16915     79 SVERLGGSITVESEPGGGTTFSI 101
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
1223-1338 3.46e-14

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568 [Multi-domain]  Cd Length: 129  Bit Score: 70.39  E-value: 3.46e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFaSEF---RVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIPMVLLT 1299
Cdd:PRK10610     9 LVVDDFSTMRRIVRNLL-KELgfnNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVT 87
                           90       100       110
                   ....*....|....*....|....*....|....*....
gi 1119624474 1300 AKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK10610    88 AEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK 126
PRK10755 PRK10755
sensor protein BasS/PmrB; Provisional
921-1152 3.69e-14

sensor protein BasS/PmrB; Provisional


Pssm-ID: 236751 [Multi-domain]  Cd Length: 356  Bit Score: 75.77  E-value: 3.69e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  921 IVTAVYILFTiyRLKHRVAMEqqlthmklRFFT-DISHELRTPLTLItgpleyvlqntKLPAEAREQLQVVERNS----- 994
Cdd:PRK10755   119 VTSALNQLVS--RLTSTLDQE--------RLFTaDVAHELRTPLAGI-----------RLHLELLEKQHHIDVAPliarl 177
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  995 NRMLRLVNQILDFRKIQNKKMKMQVQRLEIVAFVRKIM-DNFEAVAEEHHIDFVFETEKEAVYLWVDADKFEKIVYNLLS 1073
Cdd:PRK10755   178 DQMMHTVEQLLQLARAGQSFSSGHYQTVKLLEDVILPSqDELSEMLEQRQQTLLLPESAADITVQGDATLLRLLLRNLVE 257
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1074 NAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSL---FVRFenlvDSSLfnqSSSGIGLSLVKELVEMHKAS 1150
Cdd:PRK10755   258 NAHRYSPEGSTITIKLSQEDGGAVLAVEDEGPGIDESKCGELskaFVRM----DSRY---GGIGLGLSIVSRITQLHHGQ 330

                   ..
gi 1119624474 1151 IT 1152
Cdd:PRK10755   331 FF 332
HATPase_EcPhoR-like cd16952
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1070-1167 4.59e-14

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli PhoR; This family includes histidine kinase-like ATPase (HATPase) domain of two-component sensor histidine kinases similar to Escherichia coli or Vibrio cholera PhoR, the histidine kinase (HK) of PhoB-PhoR a two-component signal transduction system (TCS) involved in phosphate regulation. PhoR monitors extracellular inorganic phosphate (Pi) availability and PhoB, the response regulator, regulates transcription of genes of the phosphate regulon. PhoR is a bifunctional histidine autokinase/phospho-PhoB phosphatase; in phosphate deficiency, it autophosphorylates and Pi is transferred to PhoB, and when environmental Pi is abundant, it removes the phosphoryl group from phosphorylated PhoB. Other roles of PhoB-PhoR TCS have been described, including motility, biofilm formation, intestinal colonization, and virulence in V. cholera. E.coli PhoR and Bacillus subtilis PhoR (whose HATPase domain belongs to a different family) sense very different signals in each bacterium. In E. coli the PhoR signal comes from phosphate transport mediated by the PstSCAB2 phosphate transporter and the PhoU chaperone-like protein while in B. subtilis, the PhoR activation signal comes from wall teichoic acid (WTA) metabolism.


Pssm-ID: 340428 [Multi-domain]  Cd Length: 108  Bit Score: 69.54  E-value: 4.59e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1070 NLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSLFNQSSSGIGLSLVKELVEMHKA 1149
Cdd:cd16952      7 NLVSNAVKYTPPSDTITVRWSQEESGARLSVEDTGPGIPPEHIPRLTERFYRVDIERCRNTGGTGLGLAIVKHVMSRHDA 86
                           90
                   ....*....|....*...
gi 1119624474 1150 SITVDSKLGEGSCFKVDF 1167
Cdd:cd16952     87 RLLIASELGKGSRFTCLF 104
CitB COG4565
Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms] ...
1221-1344 8.28e-14

Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms];


Pssm-ID: 226931 [Multi-domain]  Cd Length: 224  Bit Score: 72.28  E-value: 8.28e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1221 TMLLVEDNTELRTFLRSIFA--SEFRVV-EAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHdnmtTSHIP--M 1295
Cdd:COG4565      2 NVLIIEDDPMVAEIHRRYVKqiPGFSVVgTAGTLEEAKMIIEEFKPDLILLDIYMPDGNGIELLPELR----SQHYPvdV 77
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 1119624474 1296 VLLTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKKLQE 1344
Cdd:COG4565     78 IVITAASDMETIKEALRYGVVDYLIKPFTFERLQQALTRYRQKRHALES 126
PRK10604 PRK10604
sensor protein RstB; Provisional
955-1163 1.34e-13

sensor protein RstB; Provisional


Pssm-ID: 236724 [Multi-domain]  Cd Length: 433  Bit Score: 74.64  E-value: 1.34e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  955 ISHELRTPLTlitgPLEYVLQNTKLPAEArEQlQVVERNSNRMLRLVNQILDFRKIQNKKMKMQVQRLEIVAFVRKIMDN 1034
Cdd:PRK10604   219 IAHELRTPLV----RLRYRLEMSDNLSAA-ES-QALNRDIGQLEALIEELLTYARLDRPQNELHLSEPDLPAWLSTHLAD 292
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1035 FEAVAEEHHIDfvFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTpEGKMITVFVHDnGQTVSVGVQDQGIGIAENKKKS 1114
Cdd:PRK10604   293 IQAVTPEKTVR--LDTPHQGDYGALDMRLMERVLDNLLNNALRYA-HSRVRVSLLLD-GNQACLIVEDDGPGIPPEERER 368
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1119624474 1115 LFVRFENLvDSSLFNQSSS-GIGLSLVKELVEMHKASITVD-SKLGeGSCF 1163
Cdd:PRK10604   369 VFEPFVRL-DPSRDRATGGcGLGLAIVHSIALAMGGSVNCDeSELG-GARF 417
COG3292 COG3292
Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];
169-771 1.55e-13

Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];


Pssm-ID: 225829 [Multi-domain]  Cd Length: 671  Bit Score: 75.31  E-value: 1.55e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  169 PASERLRVSRVFDVCQ-ADGAEWVLSDNGLVcftpdgaepvIYFENAEEGkdSFKKRQSFYVMEDCGDCLLFGSGNGTVW 247
Cdd:COG3292     32 DATSGLPSNVVRAMLQdADGYLWLATSDGLV----------RYDGPNDFG--VFPGNSVLGLYPDGTRLLLVSSENGLLA 99
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  248 VYRKKDRTFRPVQLDAASRISGIKHLKKL---SQVVVATVSDGFFVYDLPTGRtEHYAASR--LPAEKVKSIYRDLSDEI 322
Cdd:COG3292    100 LGALGRRDFIQVYRGGVAKSDALHELTALiddAQLLWLHASVIGVDSADALGR-EAVKDVRplLKDTPVVALVFDANGRL 178
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  323 WfeqdvvgeVAH------FNPYTrklkCEKVYAEPTNTDRsrPAFHIHEDIFGTLWVHPYGGGFSYfdrknnclrpfyns 396
Cdd:COG3292    179 W--------VGTpdglsyFDAGR----GKALQLASPPLDK--AINALIADVQGRLWVGTDQGVYLQ-------------- 230
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  397 mTGENWRFSN--------KIHSAFSDRQGNLWMCThSKGLekVTFRTDRFRLKVPV--NHSYESLSNevrALCEDKDGNM 466
Cdd:COG3292    231 -EAEGWRASNwgpmlpsgNILLLVQDAQGELWIGT-ENGL--WRTRLPRQGLQIPLskMHLGVSTVN---SLWLDTDGSL 303
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  467 WVGLKDGMLRvYNRHREEIGYL------TEAGTVsHSGKPLFGNTyfVMQDSHDNLWIAtkgagvvkAEPLPGTLRYRLT 540
Cdd:COG3292    304 WVGTYGGIVR-YLTADWKRMAVindsdgGVSQYE-AVAPALLSWG--VRQLNSIGELMV--------ANGSTGELVRSVH 371
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  541 RYRYSaddvyslsddNVYCLYEDRRGRIWVATFANGISYLtrnaDGKEVFISHRNNlKGFPIkycSKVRCITGDADGHIW 620
Cdd:COG3292    372 QLRGM----------NITTTLEDSRGRLWLGSMQNGLSRL----DNKNEWAVLDED-AGLPS---SEVSAIVEDPDNSLW 433
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  621 IGTTVGLLMVDdgfdrPEDARFyhyLRAPEKANALSNND-IHWVKPTREGELYVATFGG-------GLNQLVDLNAEGQ- 691
Cdd:COG3292    434 IGTSGGLVKRD-----PESGRV---LNLLNPGSHGLDGSrVEQLGLGPDGRLWLAAGSGvaawesqRRMFVPILDLTGQr 505
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  692 ARFKAYTVRD---------------------------GLPSDILLSIQEDKKGQLWISTENGLSKFTPGLGRFENFQnky 744
Cdd:COG3292    506 QYSFVPVGGDevwvhrlrglvrwrhswkrvalvgpqhGLPAMESLGMLHDAQGRVWLSTRRGLWRIDTDELQVRNFG--- 582
                          650       660
                   ....*....|....*....|....*..
gi 1119624474  745 SNSSIRFSEAASAyasDGNILFGTNHG 771
Cdd:COG3292    583 LRDGLGTQEFAEA---DGVLVGGTTDG 606
PRK10336 PRK10336
DNA-binding transcriptional regulator QseB; Provisional
1222-1338 3.81e-13

DNA-binding transcriptional regulator QseB; Provisional


Pssm-ID: 182387 [Multi-domain]  Cd Length: 219  Bit Score: 70.31  E-value: 3.81e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNmtTSHIPMVLLTA 1300
Cdd:PRK10336     3 ILLIEDDMLIGDGIKTGLSKMgFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREK--GQREPVLILTA 80
                           90       100       110
                   ....*....|....*....|....*....|....*...
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK10336    81 RDALAERVEGLRLGADDYLCKPFALIEVAARLEALMRR 118
PRK00742 PRK00742
chemotaxis-specific methylesterase; Provisional
1223-1383 4.58e-13

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 234828 [Multi-domain]  Cd Length: 354  Bit Score: 72.10  E-value: 4.58e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFAS--EFRVV-EAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELhdnMTTSHIPMVL-- 1297
Cdd:PRK00742     7 LVVDDSAFMRRLISEILNSdpDIEVVgTAPDGLEAREKIKKLNPDVITLDVEMPVMDGLDALEKI---MRLRPTPVVMvs 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1298 -LTAKTAIESmLEGLEYGADDYITKPFSATylkarVRNILERRKKLQEMYRE----KLMNMATSPDEPTVEESKAPEMSP 1372
Cdd:PRK00742    84 sLTERGAEIT-LRALELGAVDFVTKPFLGI-----SLGMDEYKEELAEKVRAaaraRVRALPPRAAAAARAAAAAPAALA 157
                          170
                   ....*....|.
gi 1119624474 1373 NDRKFMDKLMA 1383
Cdd:PRK00742   158 AAPLLSSKLVA 168
CheB COG2201
Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains ...
1223-1357 4.70e-13

Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains [Cell motility, Signal transduction mechanisms];


Pssm-ID: 225111 [Multi-domain]  Cd Length: 350  Bit Score: 71.94  E-value: 4.70e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1223 LLVEDNTELRTFLRSIFASE---FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELhdnMTTSHIPMVLLT 1299
Cdd:COG2201      5 LVVDDSALMRKVISDILNSDpdiEVVGTARNGREAIDKVKKLKPDVITLDVEMPVMDGLEALRKI---MRLRPLPVIMVS 81
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1119624474 1300 AKTAIES--MLEGLEYGADDYITKPF---------SATYLKARVRNILERRKK---LQEMYREKLMNMATSP 1357
Cdd:COG2201     82 SLTEEGAeaTLEALELGAVDFIAKPSggislgldeVAELLIEKVRAAARQNRKslrTPEPPRAPAFRPVKPG 153
COG3292 COG3292
Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];
9-579 6.01e-13

Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];


Pssm-ID: 225829 [Multi-domain]  Cd Length: 671  Bit Score: 73.38  E-value: 6.01e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474    9 MLAVLTAAVLKAQPEGS-FTHYSSDDGLSENTVMDMLQDSRGNMWFSTWNGINKFDGYT-FKTFKarQDNQIALTSNRVD 86
Cdd:COG3292     10 LVLVILSTATAAVPEMSrFRVLDATSGLPSNVVRAMLQDADGYLWLATSDGLVRYDGPNdFGVFP--GNSVLGLYPDGTR 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474   87 N-MKLDRYGFIWLQTYDDRAFRFDPRTEVFESVPaegePGSQTAIssikVLPDGTVWLltrreGAVRITTDSTDYrLTSV 165
Cdd:COG3292     88 LlLVSSENGLLALGALGRRDFIQVYRGGVAKSDA----LHELTAL----IDDAQLLWL-----HASVIGVDSADA-LGRE 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  166 WYSPASERLRVSRVFD-VCQADGAEWVLSDNGLvcftpdgaepviyfenaeegkdsfkkrqsfyvmedcgdcllfgsgng 244
Cdd:COG3292    154 AVKDVRPLLKDTPVVAlVFDANGRLWVGTPDGL----------------------------------------------- 186
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  245 tvwvYRKKDRTFRPVQLDAASRISGIKHL--KKLSQVVVATvSDGFFVYDLPTGRTEHYaASRLPAEKVKSIYRDLSDEI 322
Cdd:COG3292    187 ----SYFDAGRGKALQLASPPLDKAINALiaDVQGRLWVGT-DQGVYLQEAEGWRASNW-GPMLPSGNILLLVQDAQGEL 260
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  323 WF--EQDVVGEVAHFNP--YTRKLKCEKVYAeptntdrsrpAFHIHEDIFGTLWVHPYGGGFSY-----------FDRKN 387
Cdd:COG3292    261 WIgtENGLWRTRLPRQGlqIPLSKMHLGVST----------VNSLWLDTDGSLWVGTYGGIVRYltadwkrmaviNDSDG 330
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  388 NCLRPFYNSMTGENW--RFSNKIHsafsdrqgnlwMCTHSKGLEKVTFRTdRFRLKvPVNhsyeslsneVRALCEDKDGN 465
Cdd:COG3292    331 GVSQYEAVAPALLSWgvRQLNSIG-----------ELMVANGSTGELVRS-VHQLR-GMN---------ITTTLEDSRGR 388
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  466 MWVG-LKDGMLRVYNrhREEIGYLTEAgtvshSGKPLfGNTYFVMQDSHDNLWIATKGaGVVKAEPLPGTLRYRLtryry 544
Cdd:COG3292    389 LWLGsMQNGLSRLDN--KNEWAVLDED-----AGLPS-SEVSAIVEDPDNSLWIGTSG-GLVKRDPESGRVLNLL----- 454
                          570       580       590
                   ....*....|....*....|....*....|....*
gi 1119624474  545 sADDVYSLSDDNVYCLYEDRRGRIWVAtFANGISY 579
Cdd:COG3292    455 -NPGSHGLDGSRVEQLGLGPDGRLWLA-AGSGVAA 487
marine_sort_HK TIGR03785
proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is ...
938-1165 7.24e-13

proteobacterial dedicated sortase system histidine kinase; This histidine kinase protein is paired with an adjacent response regulator (TIGR03787) gene. It co-occurs with a variant sortase enzyme (TIGR03784), usually in the same gene neighborhood, in proteobacterial species most of which are marine, and with an LPXTG motif-containing sortase target conserved protein (TIGR03788). Sortases and LPXTG proteins are far more common in Gram-positive bacteria, where sortase systems mediate attachment to the cell wall or cross-linking of pilin structures. We give this predicted sensor histidine kinase the gene symbol psdS, for Proteobacterial Dedicated Sortase system Sensor histidine kinase.


Pssm-ID: 163497 [Multi-domain]  Cd Length: 703  Bit Score: 73.24  E-value: 7.24e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  938 VAMEQQLTHMKLRFFTDISHELRTPLTLITGPLEyvlqNTKLPAEAREQLQVVERNSNRMLRLvNQILDFRKiQNKKMKM 1017
Cdd:TIGR03785  475 VARLRQYTHYLENMSSRLSHELRTPVAVVRSSLE----NLELQALEQEKQKYLERAREGTERL-SMILNNMS-EATRLEQ 548
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1018 QVQRLEIVAF-----VRKIMDNFEAVAEEHhiDFVFETEKEAVYLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDN 1092
Cdd:TIGR03785  549 AIQSAEVEDFdlsevLSGCMQGYQMTYPPQ--RFELNIPETPLVMRGSPELIAQMLDKLVDNAREFSPEDGLIEVGLSQN 626
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1119624474 1093 GQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSLFNQSSSGIGLSLVKELVEMHKASITVDSKL-GEGSCFKV 1165
Cdd:TIGR03785  627 KSHALLTVSNEGPPLPEDMGEQLFDSMVSVRDQGAQDQPHLGLGLYIVRLIADFHQGRIQAENRQqNDGVVFRI 700
pleD PRK09581
response regulator PleD; Reviewed
1215-1354 1.01e-12

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 71.86  E-value: 1.01e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1215 NTDVRSTMLLVEDNTELRTFLRSIFASEFRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTSHIP 1294
Cdd:PRK09581   151 NKDEDGRILLVDDDVSQAERIANILKEEFRVVVVSDPSEALFNAAETNYDLVIVSANFENYDPLRLCSQLRSKERTRYVP 230
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1119624474 1295 MVLLTAKTAIESMLEGLEYGADDYITKPFSATYLKARVRNILeRRKKLQEMYREKL---MNMA 1354
Cdd:PRK09581   231 ILLLVDEDDDPRLVKALELGVNDYLMRPIDKNELLARVRTQI-RRKRYQDALRNNLeqsIEMA 292
HATPase_SpaK_NisK-like cd16975
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1060-1167 1.11e-12

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Bacillus subtilis SpaK and Lactococcus lactis NisK; This family includes histidine kinase-like ATPase (HATPase) domain of two-component sensor histidine kinases similar to Bacillus subtilis SpaK and Lactococcus lactis NisK. SpaK is the histidine kinase (HK) of the SpaK-SpaR two-component regulatory system (TCS), which is involved in the regulation of the biosynthesis of lantibiotic subtilin. NisK is the HK of the NisK-NisR TCS, which is involved in the regulation of the biosynthesis of lantibiotic nisin. SpaK and NisK may function as membrane-associated protein kinases that phosphorylate SpaR and NisR, respectively, in response to environmental signals.


Pssm-ID: 340434 [Multi-domain]  Cd Length: 107  Bit Score: 65.56  E-value: 1.11e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1060 DADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKK---SLFVRFENLVDSslfnQSSSGIG 1136
Cdd:cd16975      1 DTLLLSRALINIISNACQYAPEGGTVSISIYDEEEYLYFEIWDNGHGFSEQDLKkalELFYRDDTSRRS----GGHYGMG 76
                           90       100       110
                   ....*....|....*....|....*....|.
gi 1119624474 1137 LSLVKELVEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:cd16975     77 LYIAKNLVEKHGGSLIIENSQKGGAEVTVKI 107
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
1243-1366 1.23e-12

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 71.58  E-value: 1.23e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1243 FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLQMMRELHDNMTTshipMVLLTAKTAIESMLEGLEYGADDYITKP 1322
Cdd:COG3706     13 KEVATAKKGLIALAILLDHKPDYKLLDVMMPGMDGFELCRRLKAEPAT----VVMVTALDDSAPRVRGLKAGADDFLTKP 88
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*..
gi 1119624474 1323 FSATYLKARVRNiLERRKKLQEMYREKLMN---MATSPDEPTVEESK 1366
Cdd:COG3706     89 VNDSQLFLRAKS-LVRLKCSIDELRLREETggeLGVSPLLPEDAPKK 134
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
1223-1273 1.54e-12

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668 [Multi-domain]  Cd Length: 55  Bit Score: 63.36  E-value: 1.54e-12
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|..
gi 1119624474  1223 LLVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMP 1273
Cdd:smart00448    4 LVVDDDPLLRELLKALLEKEgYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK10816 PRK10816
DNA-binding transcriptional regulator PhoP; Provisional
1222-1338 2.07e-12

DNA-binding transcriptional regulator PhoP; Provisional


Pssm-ID: 182755 [Multi-domain]  Cd Length: 223  Bit Score: 68.23  E-value: 2.07e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1222 MLLVEDNTELRTFLRSIFASEFRVVEAANGAEGLEKALS-LVPDIIISDVMMPEKDGLQMMRELHDNMTTshIPMVLLTA 1300
Cdd:PRK10816     3 VLVVEDNALLRHHLKVQLQDAGHQVDAAEDAKEADYYLNeHLPDIAIVDLGLPDEDGLSLIRRWRSNDVS--LPILVLTA 80
                           90       100       110
                   ....*....|....*....|....*....|....*...
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILER 1338
Cdd:PRK10816    81 RESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRR 118
CitA COG3290
Sensor histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms];
1067-1172 2.78e-12

Sensor histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms];


Pssm-ID: 225827 [Multi-domain]  Cd Length: 537  Bit Score: 70.78  E-value: 2.78e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1067 IVYNLLSNAFKYT---PEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRfenlvDSSLFNQSSSGIGLSLVKEL 1143
Cdd:COG3290    431 ILGNLIDNALEALlapEENKEIELSLSDRGDELVIEVADTGPGIPPEVRDKIFEK-----GVSTKNTGGRGIGLYLVKQL 505
                           90       100
                   ....*....|....*....|....*....
gi 1119624474 1144 VEMHKASITVDSKLGEGSCFKVDFQKGKE 1172
Cdd:COG3290    506 VERLGGSIEVESEKGQGTRFSIYIPKVKE 534
PRK10549 PRK10549
signal transduction histidine-protein kinase BaeS; Provisional
947-1158 3.55e-12

signal transduction histidine-protein kinase BaeS; Provisional


Pssm-ID: 182539 [Multi-domain]  Cd Length: 466  Bit Score: 70.43  E-value: 3.55e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  947 MKLRFFTDISHELRTPLTLITGPLEyVLQN--TKLPAEAREQLQVverNSNRMLRLVNQI----------LDFRKIQnkk 1014
Cdd:PRK10549   239 MRRDFMADISHELRTPLAVLRGELE-AIQDgvRKFTPESVASLQA---EVGTLTKLVDDLhqlslsdegaLAYRKTP--- 311
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1015 mkmqvqrLEIVAFVRKIMDNFEAVAEEHHIDFVFETEKEAVyLWVDADKFEKIVYNLLSNAFKYTPEGKMITVFVHDNGQ 1094
Cdd:PRK10549   312 -------VDLVPLLEVAGGAFRERFASRGLTLQLSLPDSAT-VFGDPDRLMQLFNNLLENSLRYTDSGGSLHISAEQRDK 383
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1119624474 1095 TVSVGVQDQGIGIAENKKKSLFVRFENlVDSSLfNQSS--SGIGLSLVKELVEMHKASITVD-SKLG 1158
Cdd:PRK10549   384 TLRLTFADSAPGVSDEQLQKLFERFYR-TEGSR-NRASggSGLGLAICLNIVEAHNGRIIAAhSPFG 448
HATPase_BceS-YxdK-YvcQ-like cd16948
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1067-1167 4.19e-12

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Bacillus subtilis BceS, YxdK, and Bacillus thuringiensis YvcQ; This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component sensor histidine kinase (HKs) such as Bacillus subtilis BceS and Bacillus thuringiensis YvcQ, the HKs of the two-component regulatory system (TCSs) BceS-BceR and YvcQ-YvcP, repsectively, which are both involved in regulating bacitracin resistance. It also includes the HATPase domain of YxdK, the HK of YxdK-YxdJ TCS involved in sensing antimicrobial compounds.


Pssm-ID: 340424 [Multi-domain]  Cd Length: 109  Bit Score: 63.84  E-value: 4.19e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1067 IVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRF---ENlvdsSLFNQSSSGIGLSLVKEL 1143
Cdd:cd16948      9 IIGQIVSNALKYSKQGGKIEIYSETNEQGVVLSIKDFGIGIPEEDLPRVFDKGftgEN----GRNFQESTGMGLYLVKKL 84
                           90       100
                   ....*....|....*....|....
gi 1119624474 1144 VEMHKASITVDSKLGEGSCFKVDF 1167
Cdd:cd16948     85 CDKLGHKIDVESEVGEGTTFTITF 108
HATPase_CreC-like cd16945
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1065-1153 4.67e-12

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli CreC; This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component sensor histidine kinase (HKs) such as Escherichia coli CreC of the CreC-CreB two-component regulatory system (TCS) involved in catabolic regulation. Proteins having this HATPase domain also contain a histidine kinase dimerization and phosphoacceptor domain (HisKA), and accessory sensory domain(s) such as HAMP, CACHE or PAS.


Pssm-ID: 340421 [Multi-domain]  Cd Length: 106  Bit Score: 63.63  E-value: 4.67e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1065 EKIVYNLLSNAFKYTPEGKMITVFVHDNGQTVSVGVQDQGIGIAENKKKSLFVRFENLVDSSLfNQSSSGIGLSLVKELV 1144
Cdd:cd16945      6 RQAINNLLDNAIDFSPEGGLIALQLEADTEGIELLVFDEGSGIPDYALNRVFERFYSLPRPHS-GQKSTGLGLAFVQEVA 84

                   ....*....
gi 1119624474 1145 EMHKASITV 1153
Cdd:cd16945     85 QLHGGRITL 93
COG3292 COG3292
Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];
452-776 9.03e-12

Periplasmic ligand-binding sensor domain [Signal transduction mechanisms];


Pssm-ID: 225829 [Multi-domain]  Cd Length: 671  Bit Score: 69.53  E-value: 9.03e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  452 SNEVRALCEDKDGNMWVGLKDGMLRvynrhreeigYLTEAGTVSHSGKPLFGnTYFVMQD----SHDNLWIATKGAGVVK 527
Cdd:COG3292     39 SNVVRAMLQDADGYLWLATSDGLVR----------YDGPNDFGVFPGNSVLG-LYPDGTRlllvSSENGLLALGALGRRD 107
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  528 AEPLPGTLRYRLTryrySADDVYSLSDDNVYCLYEDRRGRIWVatfangISYLTRNADGKEvfishRNNLKGfpikycSK 607
Cdd:COG3292    108 FIQVYRGGVAKSD----ALHELTALIDDAQLLWLHASVIGVDS------ADALGREAVKDV-----RPLLKD------TP 166
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  608 VRCITGDADGHIWIGTTVGLLMVDDGfdrpeDARFYHY--LRAPEKANALSNNdihwvkptREGELYVATFGGglnqlVD 685
Cdd:COG3292    167 VVALVFDANGRLWVGTPDGLSYFDAG-----RGKALQLasPPLDKAINALIAD--------VQGRLWVGTDQG-----VY 228
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474  686 LNAEGQARFKAYTvrDGLPSDILLSIQEDKKGQLWISTENGLskftpGLGRFENFQNKYSNSSI--RFSEAASAYA-SDG 762
Cdd:COG3292    229 LQEAEGWRASNWG--PMLPSGNILLLVQDAQGELWIGTENGL-----WRTRLPRQGLQIPLSKMhlGVSTVNSLWLdTDG 301
                          330
                   ....*....|....
gi 1119624474  763 NILFGTNHGIFYFN 776
Cdd:COG3292    302 SLWVGTYGGIVRYL 315
FixJ COG4566
Two-component response regulator, FixJ family, consists of REC and HTH domains [Signal ...
1224-1341 2.98e-11

Two-component response regulator, FixJ family, consists of REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226932 [Multi-domain]  Cd Length: 202  Bit Score: 64.23  E-value: 2.98e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1119624474 1224 LVEDNTELRTFLRSIFASE-FRVVEAANGAEGLEKALSLVPDIIISDVMMPEKDGLqmmrELHDNMTT--SHIPMVLLTA 1300
Cdd:COG4566      9 VVDDDESVRDALAFLLESAgFQVKCFASAEEFLAAAPLDRPGCLLLDVRMPGMSGL----ELQDRLAErgIRLPVIFLTG 84
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|.
gi 1119624474 1301 KTAIESMLEGLEYGADDYITKPFSATYLKARVRNILERRKK 1341
Cdd:COG4566     85 HGDIPMAVQAMKAGAVDFLEKPFSEQDLLDAVERALARDAS 125
HATPase_PhoQ-like cd16954
Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to ...
1043-1167 9.40e-11

Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli PhoQ and Providencia stuartii AarG; This family includes histidine kinase-like ATPase (HATPase) domain of two-component sensor histidine kinases similar to Escherichia coli PhoQ and Providencia stuartii AarG. PhoQ is the histidine kinase (HK) of the PhoP-PhoQ two-component regulatory system (TCS), which responds to the levels of Mg2+ and Ca2+, controls virulence, mediates the adaptation to Mg2+-limiting environments, and regulates numerous cellular activities. Providencia stuartii AarG is a putative sensor kinase which controls the expression of the 2'-N-acetyltransferase and an intrinsic multiple antibiotic resistance (Mar) response in Providencia stuartii. The AarG product is similar to PhoQ in that it is able to restore wild-type levels of resistance to a Salmonella typhimurium phoQ mutant. However, the expression of the 2'-N-acetyltransferase gene and of aarP (a gene encoding a transcriptional activator of 2'-N-acetyltransferase) are not s