NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|754694470|ref|WP_042071873|]
View 

PBP1A family penicillin-binding protein [Advenella mimigardefordensis]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MrcA super family cl34862
Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis];
53-754 0e+00

Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis];


The actual alignment was detected with superfamily member COG5009:

Pssm-ID: 227342 [Multi-domain]  Cd Length: 797  Bit Score: 835.04  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  53 PNLPDLKAMTDYRPRVPLRVYTADKILLAEYGEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVV 132
Cdd:COG5009   32 PDLPDVETLKDVEPPVPTRVYSADGKLIAEYGEERRIPVPIDDIPDRLINAFLAAEDKRFYEHHGVDPIGIFRAAFVNLT 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 133 SGAKAQGASTITMQVARNFYLSSEKSFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSE 212
Cdd:COG5009  112 NGGRSQGASTITQQVAKNFFLSSERTLERKIKEALLAIRIEQSLSKDEILELYLNKIYLGYRAYGVAAAAQTYFGKSVNE 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 213 VSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIVLRdntqeTPETTFARHGQYVA 292
Cdd:COG5009  192 LTLAEAAMLAGLPKAPSNYNPLYNPERAKERRNYVLNRMLEEGYITQEQADEAKAEPLVAK-----YHGPEIAFSAPYFA 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 293 ELARQLMYNVYKDNV-YGRGLSVYTTIRSQDQEVAYHAVRDGIMSYTRRKPYPGPAAQVDLPAGIENNTERFDLALeeir 371
Cdd:COG5009  267 EMVRQEMIRRYGEEAaYTGGYSVYTTLDLKLQKAAQKALRNGLLDYDRRHGYRGPEAHIELSGEDWWDELAISDTL---- 342
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 372 nkyRDSDDLVTAVVLSASASKVVAARTPEQIYELSGKSLGYVKRALTNSGPTSRRIQRGSVIYLQK-VDNTWTIINMPTV 450
Cdd:COG5009  343 ---SDVGELLPAVVLSVAKSGAKIGLADGSKVTLSMEAMRWARRLLSDNKSPEDVLKPGDVIYVRKnGGGGWRLRQIPEV 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 451 EGAFISLNPQNGAIESMIGGFDFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERGVTPGTNISDQPFHLSAAQTrSKPWSP 530
Cdd:COG5009  420 NGALVSLDPKTGAILALVGGFSFAQSKFNRATQALRQPGSSFKPFVYSAALDKGLTPASVINDAPISFWDGGG-GGVWRP 498
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 531 KNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFDPARQPPksaYLTMALGAGSVTPLQMASAYSVFA 610
Cdd:COG5009  499 KNYGGKFAGPITLRQGLEQSRNLVAVRLLDAVGVDYAAEYIKRFGFYTDELPP---VLSMALGSGETTPLQMARAYAVFA 575
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 611 NGGYRVNPYIIDSVVDiSTGRVIMKAQP----------------AMAGDEANRVLDPRTAYVMNDLLRGVAKSGTAARtQ 674
Cdd:COG5009  576 NGGKRVEPYFIDRIED-RNGKVIFRAEPrvccrcnadeannqeeQTLADYAPQVIDPMTAYQITSMLRGVVQRGTAAR-A 653
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 675 ATLKRGDIGGKTGTTNQSYDAWFAGFTPKLVGISWLGFDQPKSLGDKETGGGAAMPIWLSYMQTALKKVPVTPPGPiPEG 754
Cdd:COG5009  654 GRLGRPDIAGKTGTTNDSKDAWFVGYTPDLVTGVWVGFDHPRSLGRGETGGKLALPIWIDFMKVALKGKPEKDFVP-PPG 732
 
Name Accession Description Interval E-value
MrcA COG5009
Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis];
53-754 0e+00

Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 227342 [Multi-domain]  Cd Length: 797  Bit Score: 835.04  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  53 PNLPDLKAMTDYRPRVPLRVYTADKILLAEYGEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVV 132
Cdd:COG5009   32 PDLPDVETLKDVEPPVPTRVYSADGKLIAEYGEERRIPVPIDDIPDRLINAFLAAEDKRFYEHHGVDPIGIFRAAFVNLT 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 133 SGAKAQGASTITMQVARNFYLSSEKSFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSE 212
Cdd:COG5009  112 NGGRSQGASTITQQVAKNFFLSSERTLERKIKEALLAIRIEQSLSKDEILELYLNKIYLGYRAYGVAAAAQTYFGKSVNE 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 213 VSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIVLRdntqeTPETTFARHGQYVA 292
Cdd:COG5009  192 LTLAEAAMLAGLPKAPSNYNPLYNPERAKERRNYVLNRMLEEGYITQEQADEAKAEPLVAK-----YHGPEIAFSAPYFA 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 293 ELARQLMYNVYKDNV-YGRGLSVYTTIRSQDQEVAYHAVRDGIMSYTRRKPYPGPAAQVDLPAGIENNTERFDLALeeir 371
Cdd:COG5009  267 EMVRQEMIRRYGEEAaYTGGYSVYTTLDLKLQKAAQKALRNGLLDYDRRHGYRGPEAHIELSGEDWWDELAISDTL---- 342
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 372 nkyRDSDDLVTAVVLSASASKVVAARTPEQIYELSGKSLGYVKRALTNSGPTSRRIQRGSVIYLQK-VDNTWTIINMPTV 450
Cdd:COG5009  343 ---SDVGELLPAVVLSVAKSGAKIGLADGSKVTLSMEAMRWARRLLSDNKSPEDVLKPGDVIYVRKnGGGGWRLRQIPEV 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 451 EGAFISLNPQNGAIESMIGGFDFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERGVTPGTNISDQPFHLSAAQTrSKPWSP 530
Cdd:COG5009  420 NGALVSLDPKTGAILALVGGFSFAQSKFNRATQALRQPGSSFKPFVYSAALDKGLTPASVINDAPISFWDGGG-GGVWRP 498
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 531 KNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFDPARQPPksaYLTMALGAGSVTPLQMASAYSVFA 610
Cdd:COG5009  499 KNYGGKFAGPITLRQGLEQSRNLVAVRLLDAVGVDYAAEYIKRFGFYTDELPP---VLSMALGSGETTPLQMARAYAVFA 575
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 611 NGGYRVNPYIIDSVVDiSTGRVIMKAQP----------------AMAGDEANRVLDPRTAYVMNDLLRGVAKSGTAARtQ 674
Cdd:COG5009  576 NGGKRVEPYFIDRIED-RNGKVIFRAEPrvccrcnadeannqeeQTLADYAPQVIDPMTAYQITSMLRGVVQRGTAAR-A 653
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 675 ATLKRGDIGGKTGTTNQSYDAWFAGFTPKLVGISWLGFDQPKSLGDKETGGGAAMPIWLSYMQTALKKVPVTPPGPiPEG 754
Cdd:COG5009  654 GRLGRPDIAGKTGTTNDSKDAWFVGYTPDLVTGVWVGFDHPRSLGRGETGGKLALPIWIDFMKVALKGKPEKDFVP-PPG 732
PBP_1a_fam TIGR02074
penicillin-binding protein, 1A family; Bacterial that synthesize a cell wall of peptidoglycan ...
87-742 0e+00

penicillin-binding protein, 1A family; Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]


Pssm-ID: 273955 [Multi-domain]  Cd Length: 531  Bit Score: 579.99  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470   87 RRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEKSFIRKFYEL 166
Cdd:TIGR02074   1 RREYVPIDDIPENLINAFLAIEDRRFYDHFGIDLKGIGRAAVANITSGRVLEGGSTITQQLAKNLYLTNERTITRKIQEA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  167 MLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLKRAVARQHY 246
Cdd:TIGR02074  81 LLALKLEQKLSKDEILELYLNRIYFGNGAYGIEAAAQFYFGKSVNDLTLAEAAMLAGLPKAPSAYNPFKNPERAKDRRNL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  247 VLDRMEKLGYITPEQHQEALAQKIVLRDNTQETPETTFarhgQYVAELARQLMYNVYKDNVYGRGLSVYTTIRSQDQEVA 326
Cdd:TIGR02074 161 VLSNMVENGYITAEEAEEAINEPIQLYLQTKKSEQYKA----PYFVDYVIQELEEEYGEELYTGGLKIYTTLDLDAQKAA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  327 YHAVRDGImsytrrkpypgpaaqvdlpagiennterfdlaleeiRNKYRDSDDLVtavvlsasaskvvaartpeqiyels 406
Cdd:TIGR02074 237 EKVLNTGL------------------------------------RVAGRRDGDDL------------------------- 255
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  407 gkslgyvkraltnsgptsrriqrgsviylqkvdntwtiinmptvEGAFISLNPQNGAIESMIGGFDFNRGDFNRVTQAWR 486
Cdd:TIGR02074 256 --------------------------------------------QAALVAIDPDTGAVRALVGGRDYGKSQFNRATQAKR 291
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  487 QPGSTFKPFVYAAGLERGVTPGTNISDQPFHLSaaqtRSKPWSPKNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEF 566
Cdd:TIGR02074 292 QPGSTFKPFVYAAALEKGLTPATIVNDEPITYN----GNGPWSPKNYGGGYRGNVTLRQALAQSRNIPAVRLLQEVGLDK 367
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  567 ASEFISRFGFDparqPPKSAYLTMALGAGSVTPLQMASAYSVFANGGYRVNPYIIDSVVDiSTGRVIMKAQPamagdEAN 646
Cdd:TIGR02074 368 VVALAKRFGIT----SPLDPVLSLALGTVEVSPLEMASAYAVFANGGKYVEPHGIRKIVD-RDGKVIYENKP-----KTT 437
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  647 RVLDPRTAYVMNDLLRGVAKSGTAARtqATLKRGDIGGKTGTTNQSYDAWFAGFTPKLVGISWLGFDQPKSLGDKETGGG 726
Cdd:TIGR02074 438 QVISPATAYIMTDMLKGVVESGTGRS--ARLPGRPVAGKTGTTQNWRDAWFVGYTPYYVTAVWVGYDDKKTLGKSGTGGG 515
                         650
                  ....*....|....*.
gi 754694470  727 AAMPIWLSYMQTALKK 742
Cdd:TIGR02074 516 LAAPIWRDFMAEALKN 531
mrcA PRK11636
penicillin-binding protein 1a; Provisional
53-758 0e+00

penicillin-binding protein 1a; Provisional


Pssm-ID: 183248 [Multi-domain]  Cd Length: 850  Bit Score: 572.85  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  53 PNLPDLKAMTDYRPRVPLRVYTADKILLAEYGEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVV 132
Cdd:PRK11636  31 PQLPDVATLKDVRLQTPMQVYSADGELIAQYGEKRRIPLTLDQIPPEMVKAFIATEDSRFYEHHGVDPVGIFRAASVALF 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 133 SGAKAQGASTITMQVARNFYLSSEKSFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSE 212
Cdd:PRK11636 111 SGHASQGASTITQQLARNFFLSPERTLMRKIKEAFLAIRIEQLLTKDEILELYLNKIYLGYRAYGVGAAAQVYFGKTVDQ 190
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 213 VSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIVLRdntQETPETTFArhGQYVA 292
Cdd:PRK11636 191 LTLSEMAVIAGLPKAPSTFNPLYSMDRAVARRNVVLSRMLDEGYITQAQYDQARSEPIVAN---YHAPEIAFS--APYLS 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 293 ELARQLMYNVYKDNVYGRGLSVYTTIRSQDQEVAYHAVRDGIMSYTRRKPYPGPAAQVDLPAGIENNTERFDLALEEIRN 372
Cdd:PRK11636 266 EMVRQEMYNRYGENAYEDGYRVYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNKKITDTLKALPT 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 373 kyrdSDDLVTAVVLSASASKVVAARTPEQIYELSGKSLGYVK--RALTNSGPTSRR----IQRGSVIYLQKVDNTWTIIN 446
Cdd:PRK11636 346 ----YGPLLPAVVTSANPQEATAMLADGSSVALPMEGVRWARpyRSDTQQGPTPRKvtdvVQTGQQIWVRQVDDAWWLAQ 421
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 447 MPTVEGAFISLNPQNGAIESMIGGFDFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERGVTPGTNISDQPFHLSAAQTRSK 526
Cdd:PRK11636 422 VPDVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDAGAGSD 501
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 527 pWSPKNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFdPARQPPKSAylTMALGAGSVTPLQMASAY 606
Cdd:PRK11636 502 -WRPKNSPPQYAGPIRLRQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGF-PAQNIVHTE--SLALGSASFTPMQVARGY 577
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 607 SVFANGGYRVNPYIIDSVVDiSTGRVIMKAQPAMAGDEANRVL----DPRTAYVMNDLLRGVAKS--------------- 667
Cdd:PRK11636 578 AVMANGGFLVDPYFISKIEN-DQGGVIFEAKPKVACPECDIPViygdTQKSNVLENDDVENVATSqeqqnssvpmpqleq 656
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 668 ------------------------------------------GTAARTQATLKRGDIGGKTGTTNQSYDAWFAGFTPKLV 705
Cdd:PRK11636 657 anqalvaqngaqeyaphvintplafliksalntnifgepgwmGTGWRAGRDLKRRDIGGKTGTTNSSKDAWFSGYGPGVV 736
                        730       740       750       760       770       780
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 754694470 706 GISWLGFD-QPKSLG---------DKETG--GGA--AMPIWLSYMQTALKKVPVTPPGPiPEGLAKV 758
Cdd:PRK11636 737 TSVWIGFDdHRRDLGrttasgaikDQISGyeGGAksAQPAWDDYMKAALEGVPEQPLTP-PPGIVTV 802
Transgly pfam00912
Transglycosylase; The penicillin-binding proteins are bifunctional proteins consisting of ...
79-252 3.84e-84

Transglycosylase; The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.


Pssm-ID: 334311 [Multi-domain]  Cd Length: 177  Bit Score: 265.53  E-value: 3.84e-84
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470   79 LLAEYGEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEKS 158
Cdd:pfam00912   4 LLAELGEENREWVPLDDIPPALKNAVLAIEDRRFYEHGGVDPKGIARALLKNLRGGRVVQGGSTITQQLAKNLFLTPERT 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  159 FIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLK 238
Cdd:pfam00912  84 LTRKLKEAILALKLERRYSKDEILEAYLNTVYFGNGAYGIEAAARAYFGKDASDLTLAEAALLAGLPQAPSRYNPLRNPE 163
                         170
                  ....*....|....
gi 754694470  239 RAVARQHYVLDRME 252
Cdd:pfam00912 164 RAKKRRNLVLDRMV 177
 
Name Accession Description Interval E-value
MrcA COG5009
Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis];
53-754 0e+00

Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 227342 [Multi-domain]  Cd Length: 797  Bit Score: 835.04  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  53 PNLPDLKAMTDYRPRVPLRVYTADKILLAEYGEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVV 132
Cdd:COG5009   32 PDLPDVETLKDVEPPVPTRVYSADGKLIAEYGEERRIPVPIDDIPDRLINAFLAAEDKRFYEHHGVDPIGIFRAAFVNLT 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 133 SGAKAQGASTITMQVARNFYLSSEKSFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSE 212
Cdd:COG5009  112 NGGRSQGASTITQQVAKNFFLSSERTLERKIKEALLAIRIEQSLSKDEILELYLNKIYLGYRAYGVAAAAQTYFGKSVNE 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 213 VSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIVLRdntqeTPETTFARHGQYVA 292
Cdd:COG5009  192 LTLAEAAMLAGLPKAPSNYNPLYNPERAKERRNYVLNRMLEEGYITQEQADEAKAEPLVAK-----YHGPEIAFSAPYFA 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 293 ELARQLMYNVYKDNV-YGRGLSVYTTIRSQDQEVAYHAVRDGIMSYTRRKPYPGPAAQVDLPAGIENNTERFDLALeeir 371
Cdd:COG5009  267 EMVRQEMIRRYGEEAaYTGGYSVYTTLDLKLQKAAQKALRNGLLDYDRRHGYRGPEAHIELSGEDWWDELAISDTL---- 342
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 372 nkyRDSDDLVTAVVLSASASKVVAARTPEQIYELSGKSLGYVKRALTNSGPTSRRIQRGSVIYLQK-VDNTWTIINMPTV 450
Cdd:COG5009  343 ---SDVGELLPAVVLSVAKSGAKIGLADGSKVTLSMEAMRWARRLLSDNKSPEDVLKPGDVIYVRKnGGGGWRLRQIPEV 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 451 EGAFISLNPQNGAIESMIGGFDFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERGVTPGTNISDQPFHLSAAQTrSKPWSP 530
Cdd:COG5009  420 NGALVSLDPKTGAILALVGGFSFAQSKFNRATQALRQPGSSFKPFVYSAALDKGLTPASVINDAPISFWDGGG-GGVWRP 498
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 531 KNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFDPARQPPksaYLTMALGAGSVTPLQMASAYSVFA 610
Cdd:COG5009  499 KNYGGKFAGPITLRQGLEQSRNLVAVRLLDAVGVDYAAEYIKRFGFYTDELPP---VLSMALGSGETTPLQMARAYAVFA 575
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 611 NGGYRVNPYIIDSVVDiSTGRVIMKAQP----------------AMAGDEANRVLDPRTAYVMNDLLRGVAKSGTAARtQ 674
Cdd:COG5009  576 NGGKRVEPYFIDRIED-RNGKVIFRAEPrvccrcnadeannqeeQTLADYAPQVIDPMTAYQITSMLRGVVQRGTAAR-A 653
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 675 ATLKRGDIGGKTGTTNQSYDAWFAGFTPKLVGISWLGFDQPKSLGDKETGGGAAMPIWLSYMQTALKKVPVTPPGPiPEG 754
Cdd:COG5009  654 GRLGRPDIAGKTGTTNDSKDAWFVGYTPDLVTGVWVGFDHPRSLGRGETGGKLALPIWIDFMKVALKGKPEKDFVP-PPG 732
PBP_1a_fam TIGR02074
penicillin-binding protein, 1A family; Bacterial that synthesize a cell wall of peptidoglycan ...
87-742 0e+00

penicillin-binding protein, 1A family; Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]


Pssm-ID: 273955 [Multi-domain]  Cd Length: 531  Bit Score: 579.99  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470   87 RRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEKSFIRKFYEL 166
Cdd:TIGR02074   1 RREYVPIDDIPENLINAFLAIEDRRFYDHFGIDLKGIGRAAVANITSGRVLEGGSTITQQLAKNLYLTNERTITRKIQEA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  167 MLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLKRAVARQHY 246
Cdd:TIGR02074  81 LLALKLEQKLSKDEILELYLNRIYFGNGAYGIEAAAQFYFGKSVNDLTLAEAAMLAGLPKAPSAYNPFKNPERAKDRRNL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  247 VLDRMEKLGYITPEQHQEALAQKIVLRDNTQETPETTFarhgQYVAELARQLMYNVYKDNVYGRGLSVYTTIRSQDQEVA 326
Cdd:TIGR02074 161 VLSNMVENGYITAEEAEEAINEPIQLYLQTKKSEQYKA----PYFVDYVIQELEEEYGEELYTGGLKIYTTLDLDAQKAA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  327 YHAVRDGImsytrrkpypgpaaqvdlpagiennterfdlaleeiRNKYRDSDDLVtavvlsasaskvvaartpeqiyels 406
Cdd:TIGR02074 237 EKVLNTGL------------------------------------RVAGRRDGDDL------------------------- 255
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  407 gkslgyvkraltnsgptsrriqrgsviylqkvdntwtiinmptvEGAFISLNPQNGAIESMIGGFDFNRGDFNRVTQAWR 486
Cdd:TIGR02074 256 --------------------------------------------QAALVAIDPDTGAVRALVGGRDYGKSQFNRATQAKR 291
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  487 QPGSTFKPFVYAAGLERGVTPGTNISDQPFHLSaaqtRSKPWSPKNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEF 566
Cdd:TIGR02074 292 QPGSTFKPFVYAAALEKGLTPATIVNDEPITYN----GNGPWSPKNYGGGYRGNVTLRQALAQSRNIPAVRLLQEVGLDK 367
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  567 ASEFISRFGFDparqPPKSAYLTMALGAGSVTPLQMASAYSVFANGGYRVNPYIIDSVVDiSTGRVIMKAQPamagdEAN 646
Cdd:TIGR02074 368 VVALAKRFGIT----SPLDPVLSLALGTVEVSPLEMASAYAVFANGGKYVEPHGIRKIVD-RDGKVIYENKP-----KTT 437
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  647 RVLDPRTAYVMNDLLRGVAKSGTAARtqATLKRGDIGGKTGTTNQSYDAWFAGFTPKLVGISWLGFDQPKSLGDKETGGG 726
Cdd:TIGR02074 438 QVISPATAYIMTDMLKGVVESGTGRS--ARLPGRPVAGKTGTTQNWRDAWFVGYTPYYVTAVWVGYDDKKTLGKSGTGGG 515
                         650
                  ....*....|....*.
gi 754694470  727 AAMPIWLSYMQTALKK 742
Cdd:TIGR02074 516 LAAPIWRDFMAEALKN 531
mrcA PRK11636
penicillin-binding protein 1a; Provisional
53-758 0e+00

penicillin-binding protein 1a; Provisional


Pssm-ID: 183248 [Multi-domain]  Cd Length: 850  Bit Score: 572.85  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  53 PNLPDLKAMTDYRPRVPLRVYTADKILLAEYGEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVV 132
Cdd:PRK11636  31 PQLPDVATLKDVRLQTPMQVYSADGELIAQYGEKRRIPLTLDQIPPEMVKAFIATEDSRFYEHHGVDPVGIFRAASVALF 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 133 SGAKAQGASTITMQVARNFYLSSEKSFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSE 212
Cdd:PRK11636 111 SGHASQGASTITQQLARNFFLSPERTLMRKIKEAFLAIRIEQLLTKDEILELYLNKIYLGYRAYGVGAAAQVYFGKTVDQ 190
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 213 VSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIVLRdntQETPETTFArhGQYVA 292
Cdd:PRK11636 191 LTLSEMAVIAGLPKAPSTFNPLYSMDRAVARRNVVLSRMLDEGYITQAQYDQARSEPIVAN---YHAPEIAFS--APYLS 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 293 ELARQLMYNVYKDNVYGRGLSVYTTIRSQDQEVAYHAVRDGIMSYTRRKPYPGPAAQVDLPAGIENNTERFDLALEEIRN 372
Cdd:PRK11636 266 EMVRQEMYNRYGENAYEDGYRVYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNKKITDTLKALPT 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 373 kyrdSDDLVTAVVLSASASKVVAARTPEQIYELSGKSLGYVK--RALTNSGPTSRR----IQRGSVIYLQKVDNTWTIIN 446
Cdd:PRK11636 346 ----YGPLLPAVVTSANPQEATAMLADGSSVALPMEGVRWARpyRSDTQQGPTPRKvtdvVQTGQQIWVRQVDDAWWLAQ 421
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 447 MPTVEGAFISLNPQNGAIESMIGGFDFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERGVTPGTNISDQPFHLSAAQTRSK 526
Cdd:PRK11636 422 VPDVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDAGAGSD 501
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 527 pWSPKNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFdPARQPPKSAylTMALGAGSVTPLQMASAY 606
Cdd:PRK11636 502 -WRPKNSPPQYAGPIRLRQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGF-PAQNIVHTE--SLALGSASFTPMQVARGY 577
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 607 SVFANGGYRVNPYIIDSVVDiSTGRVIMKAQPAMAGDEANRVL----DPRTAYVMNDLLRGVAKS--------------- 667
Cdd:PRK11636 578 AVMANGGFLVDPYFISKIEN-DQGGVIFEAKPKVACPECDIPViygdTQKSNVLENDDVENVATSqeqqnssvpmpqleq 656
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 668 ------------------------------------------GTAARTQATLKRGDIGGKTGTTNQSYDAWFAGFTPKLV 705
Cdd:PRK11636 657 anqalvaqngaqeyaphvintplafliksalntnifgepgwmGTGWRAGRDLKRRDIGGKTGTTNSSKDAWFSGYGPGVV 736
                        730       740       750       760       770       780
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 754694470 706 GISWLGFD-QPKSLG---------DKETG--GGA--AMPIWLSYMQTALKKVPVTPPGPiPEGLAKV 758
Cdd:PRK11636 737 TSVWIGFDdHRRDLGrttasgaikDQISGyeGGAksAQPAWDDYMKAALEGVPEQPLTP-PPGIVTV 802
MrcB COG0744
Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis] ...
56-813 4.57e-178

Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 223815 [Multi-domain]  Cd Length: 661  Bit Score: 526.93  E-value: 4.57e-178
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  56 PDLKAMTDYRPRVPLRVYTADKILLAEY-GEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSG 134
Cdd:COG0744   43 ILLDLLVPQTPKSTTIYDRDGKLILTLYsGEEHREWVPLDQIPPNLKQALIAIEDRRFYEHHGIDPKGIGRAALANNLSG 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 135 AK-AQGASTITMQVARNFYLSSEKSFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSEV 213
Cdd:COG0744  123 GGvSQGGSTITQQLAKNLFLSNERTLDRKAKEAVLALWLEALYSKDEILEMYLNQVYFGRGAYGVEAAAQYYFGKPAKDL 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 214 SIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIVLRDNTQETPETTFARHGQYVAE 293
Cdd:COG0744  203 TLAQAALLAGLLKAPSLYNPYRPPEYARARRNLVLRRMVEQGYITAEEYDAALAEPLQVQQAKTVATSPPPYFDDVVRQE 282
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 294 LARQLmynvYKDNVYGRGLSVYTTIRSQDQEVAYHAVrdgimsytrrkpypgpaaqvdlpagiennterfdlaleeirnk 373
Cdd:COG0744  283 LAELL----GESDLLTGGLKVYTTLDPELQEAAEKAV------------------------------------------- 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 374 yrdsddlvtavvlsasaskvvaartpeQIYELSGkslgyvkraltnsgptsrriqrgsviylqkvdntwtiinMPTVEGA 453
Cdd:COG0744  316 ---------------------------QADPLYK---------------------------------------LRDVQAA 329
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 454 FISLNPQNGAIESMIGGFDFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERG-VTPGTNISDQPfhlsaaqTRSKPWSPKN 532
Cdd:COG0744  330 LVLIDPKTGAVRALVGGRDYQPSGFNRATQAKRQPGSTFKPFLYYAALEEGkATPSTIVVDAP-------VTYGNWSPKN 402
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 533 YGNSYS-YSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFDparqPPKSAYLTMALGAGSVTPLQMASAYSVFAN 611
Cdd:COG0744  403 YDGRYEgGSVTLREALATSLNIPAVRLLQKVGLDKVVDTAKKLGIN----SPLVPGPSLALGASEVSPLEMASAYATFAN 478
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 612 GGYRVNPYIIDSVVDiSTGrVIMKAQPamagdEANRVLDPRTAYVMNDLLRGVAKSgTAARTQATLKRGDIGGKTGTTNQ 691
Cdd:COG0744  479 GGTYYPPHFIRKVTD-ADG-VLYDNPP-----KVKRVLSPQAAYLMTDMLQGVVTP-TGTGAAAKLPGPYAAGKTGTTND 550
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 692 SYDAWFAGFTPKLVGISWLGFDQpkSLGDKETGGGAAMPIWLSYMQTALKKVPVTP-PGPIPEglakvgdnfyfsefPLG 770
Cdd:COG0744  551 NRDAWFVGYTPQLTTAVWLGNDD--NPLTPLTGGSDAAAIWKEFMGQALPGGLRVPfPFTDPD--------------PEG 614
                        730       740       750       760
                 ....*....|....*....|....*....|....*....|...
gi 754694470 771 KALANIGVSGAGRDPNAAKPAGSQSGDAIGKALESFNPMGGPP 813
Cdd:COG0744  615 AGTLRAAGGTARPVYVSAPPPDGAPGVPGGKTGTPDNRLPPAS 657
PBP_1b TIGR02071
penicillin-binding protein 1B; Bacterial that synthesize a cell wall of peptidoglycan (murein) ...
84-763 2.61e-106

penicillin-binding protein 1B; Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]


Pssm-ID: 273952 [Multi-domain]  Cd Length: 730  Bit Score: 342.86  E-value: 2.61e-106
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470   84 GEERRNVlRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEKSFIRKF 163
Cdd:TIGR02071 144 GEQRLFV-PRDQFPELLVDTLLATEDRDFYEHDGISLYSIGRAVWVNLTAGRTVQGGSTLTQQLVKNLFLSNERSLWRKA 222
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  164 YELMLTYKIEQNLSKDQILELYLNQIYLGHRS----YGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLKR 239
Cdd:TIGR02071 223 NEAYMALILDARYSKDRILELYLNEVYLGQSGddaiHGFPLASQYYFGRPLGELSLDQVALLVGMVKGPSYYNPWRNPDR 302
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  240 AVARQHYVLDRMEKLGYITPEQHQEALAQKIvlrdNTQETPETTfARHGQYVAELARQLMYNVYKDNVYGRGLSVYTTIR 319
Cdd:TIGR02071 303 ALERRNLVLRLLQEQKIIDDEEYDMLSARPL----GVQKKGGII-SRQPAFLQLVRRELRQKLGDKVKDLSGLRIFTTLD 377
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  320 SQDQEVAYHAVRDGIMSYTRRKpypgpaaqvdlpagiennterfdlaleeirnkyrdsddlvtavvlsasaskvvaartp 399
Cdd:TIGR02071 378 PVSQSAAEQAVQETIPALKKKK---------------------------------------------------------- 399
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  400 eqiyelsgkslgyvkraltnsgptsrriqrgsviylqkvdntwtiiNMPTVEGAFISLNPQNGAIESMIGGFDFNRGDFN 479
Cdd:TIGR02071 400 ----------------------------------------------KLPDLEAAMVVTDRFTGEVRAMVGGSDPQFAGFN 433
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  480 RVTQAWRQPGSTFKPFVYAAGLER--GVTPGTNISDQPFHLSAAQtrSKPWSPKNYGNSYSYSQTMRQGLYKSKNMVSIR 557
Cdd:TIGR02071 434 RALQARRQIGSLVKPAVYLTALSQpdKYRLNTWIEDQPLSIKLSN--GQVWSPQNYDRRYSGTVMLYDALAHSLNIPTVN 511
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  558 ILQTVGPEFASEFISRFGFDPARQPPksaYLTMALGAGSVTPLQMASAYSVFANGGYRVNPYIIDSVVDiSTGRVIMKAQ 637
Cdd:TIGR02071 512 LGMKVGLPKVSQTWNKLGINKDEIPP---VPSMLLGAINLTPYEVAQLYQTIASGGNRAPLSAVRSVLD-EDGKVLYQSD 587
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  638 PamagdEANRVLDPRTAYVMNDLLRGVAKSGTAARTQATLKRGDIGGKTGTTNQSYDAWFAGFTPKLVGISWLGFD--QP 715
Cdd:TIGR02071 588 P-----QAEQAVPSQAAYLTLYAMQQVVQRGTARSLGADFPSLSLAGKTGTTNDNRDSWFAGIDGKEVTIIWLGRDdnGP 662
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|....*...
gi 754694470  716 KSLgdkeTGGGAAMPIWLSYMQtalKKVPVTPPGPIPEGLAKVGDNFY 763
Cdd:TIGR02071 663 TKL----TGASGALQVYARYLS---YQTPEPLLLVPPEGIDWFGVDPQ 703
Transgly pfam00912
Transglycosylase; The penicillin-binding proteins are bifunctional proteins consisting of ...
79-252 3.84e-84

Transglycosylase; The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.


Pssm-ID: 334311 [Multi-domain]  Cd Length: 177  Bit Score: 265.53  E-value: 3.84e-84
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470   79 LLAEYGEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEKS 158
Cdd:pfam00912   4 LLAELGEENREWVPLDDIPPALKNAVLAIEDRRFYEHGGVDPKGIARALLKNLRGGRVVQGGSTITQQLAKNLFLTPERT 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  159 FIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLK 238
Cdd:pfam00912  84 LTRKLKEAILALKLERRYSKDEILEAYLNTVYFGNGAYGIEAAARAYFGKDASDLTLAEAALLAGLPQAPSRYNPLRNPE 163
                         170
                  ....*....|....
gi 754694470  239 RAVARQHYVLDRME 252
Cdd:pfam00912 164 RAKKRRNLVLDRMV 177
PbpC COG4953
Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope ...
47-752 1.20e-75

Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 227289 [Multi-domain]  Cd Length: 733  Bit Score: 260.40  E-value: 1.20e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  47 AVALTWPnlPDLKAMTDYRPRV------PLRVYTADkillaeyGEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDW 120
Cdd:COG4953   20 ALDKLFP--PPLVEARQYSRVVldrdgtLLRAFADK-------DGEWRIPTPLEEVSPQFIEALINYEDKRFYWHPGVDP 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 121 SGVGRAVIANVVSGAKAQGASTITMQVARNFYlSSEKSFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAA 200
Cdd:COG4953   91 LALLRAAWQTLTSGRVVSGGSTLTMQVARLLE-PRPRTLGGKIRQIWRAIQLESRLSKREILELYLNRAPYGGNIEGVRA 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 201 ASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIVLRDNTQEtp 280
Cdd:COG4953  170 ASLAYFGKEPKRLSLAEAALLAVLPQNPERRRPDRNPEAAEAARNRVLTRMAVQGVWSEEEAKRARLEPVPNRRRQLP-- 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 281 etTFARHgqYVAELARQlmynvykdnvYGRGLSVYTTIRSQDQEVAYHAVRDGImsyTRRKPYpgpaaqvdlpagiennt 360
Cdd:COG4953  248 --FLAPH--FAFRLLNQ----------YPKGDIIVTTLDANLQRRLEEQARDYA---SRLGPR----------------- 293
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 361 erfdlaleeirnkyrdsddlVTAVVLsasaskVVAARTpeqiyelsGKSLGYVkraltnsgptsrriqrGSVIYLQKVDN 440
Cdd:COG4953  294 --------------------NSAAVL------VVDNRT--------MEVLAYV----------------GSADFFDASRS 323
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 441 TWtiINMptvegafislnpqngaiesmiggfdfnrgdfnrvTQAWRQPGSTFKPFVYAAGLERG-VTPGTNISDQPfhls 519
Cdd:COG4953  324 GH--IDM----------------------------------VRALRSPGSTLKPFVYGLAFDQGlIHPETLLKDVP---- 363
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 520 aaqTRSKPWSPKNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFDPaRQPPKSAY-LTMALGAGSVT 598
Cdd:COG4953  364 ---TRFGDYRPENFDSNFHGPVSVREALIKSLNIPAVRLLEAVGPPRFAARLRQAGVHL-YLPEGAAPgLSLILGGAGIT 439
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 599 PLQMASAYSVFANGGyRVNPyiidsvvdistgrviMKAQPAMAGDEANRVLDPRTAYVMNDLLRGVAKSGTAARTQATLk 678
Cdd:COG4953  440 LEDLAQLYAALANQG-KAGP---------------LRDTLDDDPLTERTLLSPGAAWQILDILSDVARPGLPNGALPSV- 502
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 754694470 679 RGdIGGKTGTTNQSYDAWFAGFTPKLVGISWLG-FDQpKSLGdKETGGGAAMPIWLSYMQtALKKVPVTPPGPIP 752
Cdd:COG4953  503 RP-IAWKTGTSYGYRDAWSVGVFGRYVLGVWVGrFDG-TPVP-GLSGVATAAPLLFQVNN-IIARSGRLAELPRP 573
mrcB PRK09506
bifunctional glycosyl transferase/transpeptidase; Reviewed
78-762 4.78e-72

bifunctional glycosyl transferase/transpeptidase; Reviewed


Pssm-ID: 236544 [Multi-domain]  Cd Length: 830  Bit Score: 252.38  E-value: 4.78e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  78 ILLAEYGEERRNVLRfNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEK 157
Cdd:PRK09506 202 MLQSPNGEQRLFVPR-SGFPDLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGGSTLTQQLVKNLFLSNER 280
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 158 SFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRS----YGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNP 233
Cdd:PRK09506 281 SLWRKANEAYMALIMDARYSKDRILELYLNEVYLGQSGddqiRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASLYNP 360
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 234 RANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKI-VLRDNTQETPETTFarhgqyvAELARQLMYNVYKDNVYG-RG 311
Cdd:PRK09506 361 WRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLgVQPKGGVISPQPAF-------MQMVRQELQAKLGDKVKDlSG 433
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 312 LSVYTTIRSQDQEVAYHAVRDGImsytrrkpypgPAAQvdlpagiennterfdlaleeirnKYRDSDDLVTAVVLsasas 391
Cdd:PRK09506 434 VKIFTTLDPVSQDAAEKAVEEGI-----------PALK-----------------------KQRKLSDLETAMVV----- 474
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 392 kvvaartpeqiyelsgkslgyvkraltnsgptsrrIQRGSviylqkvdntwtiinmptvegafislnpqnGAIESMIGGF 471
Cdd:PRK09506 475 -----------------------------------VDRFS------------------------------GEVRAMVGGS 489
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 472 DFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERGVTPGTN--ISDQPFHLSaaQTRSKPWSPKNYGNSYSYSQTMRQGLYK 549
Cdd:PRK09506 490 EPQFAGYNRAMQARRSIGSLAKPATYLTALSQPDKYRLNtwIADAPISLR--QPNGQVWSPQNDDRRFSGRVMLVDALTR 567
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 550 SKNMVSIRILQTVGPEFASEFISRFGFDPARQPPKSAyltMALGAGSVTPLQMASAYSVFANGGYRVNPYIIDSVVDiST 629
Cdd:PRK09506 568 SMNVPTVNLGMALGLPAVTDTWIKLGVPKDQLNPVPA---MLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIA-ED 643
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 630 GRVIMKAQPamagdEANRVLDPRTAYVMNDLLRGVAKSGTAARTQATLKRGDIGGKTGTTNQSYDAWFAGFTPKLVGISW 709
Cdd:PRK09506 644 GKVLYQSFP-----QAERAVPAQAAYLTLYTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNDLVDSWFAGIDGKEVTITW 718
                        650       660       670       680       690
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 754694470 710 LGFD--QPKSLgdkeTGGGAAMPIWLSYM--QTALKKVPVTPPGPIPEGLAKVGdNF 762
Cdd:PRK09506 719 VGRDnnQPTKL----YGASGAMTIYQRYLenQTPTPLNLTPPEDIVDMGVDYDG-NF 770
PBP_1c TIGR02073
penicillin-binding protein 1C; This subfamily of the penicillin binding proteins includes the ...
69-753 9.99e-67

penicillin-binding protein 1C; This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]


Pssm-ID: 273954 [Multi-domain]  Cd Length: 727  Bit Score: 235.78  E-value: 9.99e-67
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470   69 PLRVYTADKillaeygEERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVA 148
Cdd:TIGR02073  21 LLRALLAND-------GQWRLPVPLEDISPKFLQALLLYEDKRFYWHPGVNPLALLRAAWQNLTNGRRVSGGSTLTMQLA 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  149 RNFYLSSEKSFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAP 228
Cdd:TIGR02073  94 RLLDPELSRTLTGKLRQMWRAIQLEARYSKREILEAYLNLAPYGGNLEGLRAASLIYFGKEPSSLSLAEAALLAALPQAP 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  229 SRFNPRANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIVLRDNtqETPetTFARHgqYVAELARQlmynvYKDNVY 308
Cdd:TIGR02073 174 SARRLDRLPKAAKAARDRLLDRMVEQGPDDSEQVALAALEPLPALPE--PLP--QLAPH--FALKLLRA-----RPEIAS 242
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  309 grglSVYTTIRSQDQEVAYHAVRDgimsYTRRKPypgpaaqvdlPAGIENnterfdlaleeirnkyrdsddlvTAVVLsa 388
Cdd:TIGR02073 243 ----VIVSTLDADLQRRLEELARR----YLSALR----------PRGISN-----------------------LAILV-- 279
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  389 saskvvaartpeqiyelsgkslgyvkraltnsgptsrriqrgsviylqkVDNtwtiinmptvegafislnpQNGAIESMI 468
Cdd:TIGR02073 280 -------------------------------------------------VDN-------------------RSGAVLAYV 291
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  469 GGFDFNRGD-FNRV--TQAWRQPGSTFKPFVYAAGLERG-VTPGTNISDQPFHLSAAQtrskpwsPKNYGNSYSYSQTMR 544
Cdd:TIGR02073 292 GSADFFDDSnSGQVdgVRAPRSPGSTLKPFLYALALDDGlLHPDSLLKDVPLRFGDYA-------PENFDKTFHGPVPAR 364
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  545 QGLYKSKNMVSIRILQTVGPEFASEFISRFGFDPARqpPKSAY--LTMALGAGSVTPLQMASAYSVFANGGYRVNPYIId 622
Cdd:TIGR02073 365 EALARSLNIPAVRLLERVGPPRFADFLRQAGLNLLK--PKSDYygLSLALGGAEITLQDLANLYAMLANQGLSGPLRFL- 441
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  623 svvdistgrvimkaQPAMAGDEANRVLDPRTAYVMNDLLRGVAKSGTAARTQATLKRGDIGGKTGTTNQSYDAWFAGFTP 702
Cdd:TIGR02073 442 --------------QTDAKRPERERLLSPGAAWIVLDILKDRPRPDDTLPLSALPTRLPLAWKTGTSYGFRDAWAAGVSG 507
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|...
gi 754694470  703 KLVGISWLG-FD-QPKSlgdKETGGGAAMPIWLSYMQTALKKVPVTPPGPIPE 753
Cdd:TIGR02073 508 RYTIGVWVGnFDgKPNP---GFFGAAAAAPLLFDILDALQASEASTLPRPLKE 557
PRK14850 PRK14850
penicillin-binding protein 1b; Provisional
78-737 1.04e-66

penicillin-binding protein 1b; Provisional


Pssm-ID: 237835 [Multi-domain]  Cd Length: 764  Bit Score: 236.28  E-value: 1.04e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  78 ILLAEYGEERRNVLRfNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEK 157
Cdd:PRK14850 148 MLYSPEGKKRLFIPR-NQYPEMLIKTLLAIEDKYFYEHDGIHLSSIGRAFLVNLMSGHTIQGGSTLTQQLVKNLFLTNTR 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 158 SFIRKFYELMLTYKIEQNLSKDQILELYLNQIYLGH----RSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNP 233
Cdd:PRK14850 227 SLWRKINEIYMALILDRFYSKDRILELYLNEVYLGQdgneQIRGFPLASIYYFGRPINELNLDQYALLVGMVKGASLYNP 306
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 234 RANLKRAVARQHYVLDRMEKLGYITPEQHQEALAQKIvlrdNTQETPETTFARHG--QYVAELARQLMYNVYKDNvygRG 311
Cdd:PRK14850 307 WTNPNLTLKRRNLVLFLLYKQKVITRKLYKDLCSRPL----NVQSKGNIISSHPAfiQLVCEEFHKKIHYPFKNF---SG 379
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 312 LSVYTTIRSQDQEVAYHAVRDGImsytrrkpypgpaaqvdlpagiennterfdlalEEIRNKYRDSDdlvtavvlsasas 391
Cdd:PRK14850 380 TKIFTTLDYISQNAAEQAVKIGI---------------------------------PILKRKKRLKD------------- 413
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 392 kvvaartpeqiyelsgkslgyvkraltnsgptsrriqrgsviylqkvdntwtiinmptVEGAFISLNPQNGAIESMIGGF 471
Cdd:PRK14850 414 ----------------------------------------------------------LEVAMVIIDRFSGEVRALIGSS 435
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 472 DFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERgvtP-----GTNISDQPFHLSaaQTRSKPWSPKNYGNSYSYSQTMRQG 546
Cdd:PRK14850 436 KPEFNGYNRALKARRSIGSLSKPITYLTALSQ---PekyhlNTWISDTPISIK--LDNGQYWTPKNNNFSFSGKVMLIDA 510
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 547 LYKSKNMVSIRILQTVGPEFASEFISRFGFDPARQPPksaYLTMALGAGSVTPLQMASAYSVFANGGYRVNPYIIDSVVD 626
Cdd:PRK14850 511 LIHSINIPTVHLSINLGLKKLVDSWILLGISSNYITP---LPSISLGAINLTPMEVAQVFQIIGSGGYKSSLSSIRSIIS 587
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 627 iSTGRVIMKAQPamagdEANRVLDPRTAYVMNDLLRGVAKSGTAARTQATLKRGDIGGKTGTTNQSYDAWFAGFTPKLVG 706
Cdd:PRK14850 588 -DDNKVLYQNFP-----QSKHVESSQASYLTLYAMQQVVKSGTAKSLGTIFKEFSLAGKTGTTNNLVDSWFVGIDGKQVV 661
                        650       660       670
                 ....*....|....*....|....*....|.
gi 754694470 707 ISWLGFDQPKSlgDKETGGGAAMPIWLSYMQ 737
Cdd:PRK14850 662 ITWIGRDNNHT--TKLYGSSGAMKIYKRYLQ 690
mtgA PRK00056
monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
93-256 4.51e-45

monofunctional biosynthetic peptidoglycan transglycosylase; Provisional


Pssm-ID: 234603 [Multi-domain]  Cd Length: 236  Bit Score: 161.53  E-value: 4.51e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  93 FNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEKSFIRKFYELMLTYKI 172
Cdd:PRK00056  65 YDQISPNLKRAVIAAEDQKFPEHWGFDWDAIQKALEHNERNGKRVRGASTISQQTAKNLFLWPGRSWVRKGLEAPLTLMI 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 173 EQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRME 252
Cdd:PRK00056 145 ELVWSKRRILEVYLNIAEWGPGIFGAEAAARHYFGKPASKLSASQAALLAAVLPNPRRYDAHRPSPYVRRRAAWILRQMR 224

                 ....
gi 754694470 253 KLGY 256
Cdd:PRK00056 225 QLGG 228
PRK13481 PRK13481
glycosyltransferase; Provisional
85-268 1.25e-40

glycosyltransferase; Provisional


Pssm-ID: 184078 [Multi-domain]  Cd Length: 232  Bit Score: 149.18  E-value: 1.25e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  85 EERRNVLRFNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVvSGAKAQGASTITMQVARNFYLSSEKSFIRKFY 164
Cdd:PRK13481  42 ENKSSFVSADNMPEYVKGAFISMEDERFYKHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDNERSFTRKVK 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 165 ELMLTYKIEQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYG-------KPLSEVSIAEAALLAGIPKAPSRFNPRANL 237
Cdd:PRK13481 121 ELFVAHRVEKQYSKNEILSFYLNNIYFGDNQYTLEGAANHYFGttvnknsTTMSHITVLQSAILASKVNAPSVYNINDMS 200
                        170       180       190
                 ....*....|....*....|....*....|.
gi 754694470 238 KRAVARQHYVLDRMEKLGYITPEQHQEALAQ 268
Cdd:PRK13481 201 ENFTQRVSTNLEKMKQQNYINETQYQQAMSQ 231
Transpeptidase pfam00905
Penicillin binding protein transpeptidase domain; The active site serine is conserved in all ...
452-703 1.64e-37

Penicillin binding protein transpeptidase domain; The active site serine is conserved in all members of this family.


Pssm-ID: 334309 [Multi-domain]  Cd Length: 289  Bit Score: 142.13  E-value: 1.64e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  452 GAFISLNPQNGAIESMIGGFDFNRGDF-----NRVTQAWRQPGSTFKPFVYAAGLERGV-TPGTNISDQPFHLsaaqtRS 525
Cdd:pfam00905   1 GSAVVLDPKTGEVLAMVSKPSYDPNGFvgplrNRAVTSRYEPGSTFKIATAAAALDNGViKPNETIFDWDGKI-----QG 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  526 KPWSPKNYGNSYsYSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFD-----------PARQPPKSAYLTMALGA 594
Cdd:pfam00905  76 GSIGDWNQDQPS-GSITLRQALQYSSNWYFVKLAQKLGADKLRSYLKKFGYGnktgiglpgenAGLLPDYWEGATASFGI 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  595 G-SVTPLQMASAYSVFANGGYRVNPYIIDSVVDISTGRVIMKAQpamagdeanrvldprTAYVMNDLLRGVAKSGTAART 673
Cdd:pfam00905 155 GlKITPLQQAQAYAAIANGGKLVPPHIVKKVDPKVLNKLPISKS---------------TAEKVKDMLRLVVNDGTGTAA 219
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|.
gi 754694470  674 QATLKrgdIGGKTGT-----------TNQSYDAWFAGFTPK 703
Cdd:pfam00905 220 VPGYK---VAGKTGTaqvagpkgggyYDGAYIGWFVGYAPA 257
PRK11240 PRK11240
penicillin-binding protein 1C; Provisional
103-711 2.08e-36

penicillin-binding protein 1C; Provisional


Pssm-ID: 183049 [Multi-domain]  Cd Length: 772  Bit Score: 147.15  E-value: 2.08e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 103 ALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARnFYLSSEKSFIRKFYELMLTYKIEQNLSKDQIL 182
Cdd:PRK11240  77 ALINYEDRWFWKHPGVNPFSVARAAWQDLTSGRVISGGSTLTMQVAR-LLDPHPRTFGGKIRQLWRALQLEWHLSKREIL 155
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 183 ELYLNQIYLGHRSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRMEKLGYITPEQH 262
Cdd:PRK11240 156 TLYLNRAPFGGTLQGIGAASWAYLGKSPANLSYAEAALLAVLPQAPSRLRPDRWPERAEAARNKVLERMAEQGVWSAEQV 235
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 263 QEALAQKIVLrdntqetpettFARHGQYVAELARQLMYNVYKDNVygrglsVYTTirsqdqevayhavrdgimsytrrkp 342
Cdd:PRK11240 236 KESREEPVWL-----------APRQMPQLAPLFARMMLGKSKSDK------IVTT------------------------- 273
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 343 ypgpaaqvdLPAGIENNTErfDLALEEirnKYRdsddlvtavvlsasaskvVAARTpeqiyelsgkSLGYVkraltnsgp 422
Cdd:PRK11240 274 ---------LDAGLQRRLE--DLALNW---KGR------------------LPPRS----------SLAMI--------- 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 423 tsrriqrgsviylqKVDNTwtiiNMptvegafislnpqngAIESMIGGFDFNR----GDFNRVTqAWRQPGSTFKPFVYA 498
Cdd:PRK11240 303 --------------VVDHT----DM---------------AVRGWVGSVDLNDdsrfGHVDMVN-AIRSPGSVLKPFVYG 348
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 499 AGLERG-VTPGTNISDQPfhlsaaqTRSKPWSPKNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPE-FASEFisRFGF 576
Cdd:PRK11240 349 LALDDGlIHPASLLQDVP-------RRTGDYRPGNFDSGFHGPVSMSEALVRSLNLPAVQVLEAYGPKrFAAKL--RNVG 419
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 577 DPARQPPKSA-YLTMALGAGSVTPLQMASAYSVFANGG----YRVNPYiiDSVVDistgrvimkaqpamagdeaNRVLDP 651
Cdd:PRK11240 420 LPLYLPAGAEpNLSLILGGAGARLEDMVAAYSAFARHGkaakLRLQPD--DPLLE-------------------RPLMSP 478
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 754694470 652 RTAYVMNDLLRGVAKSGTAArtqATLKRGDIGGKTGTTNQSYDAWFAGFTPK-LVGIsWLG 711
Cdd:PRK11240 479 GAAWIIRRIMADEAQPLPDA---ALPRVVPLAWKTGTSYGYRDAWAIGVNARyVIGI-WTG 535
mono_pep_trsgly TIGR02070
monofunctional biosynthetic peptidoglycan transglycosylase; This family is one of the ...
93-255 9.40e-35

monofunctional biosynthetic peptidoglycan transglycosylase; This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]


Pssm-ID: 273951 [Multi-domain]  Cd Length: 224  Bit Score: 131.82  E-value: 9.40e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470   93 FNEIPDVMKHALLAAEDDNFYNHGGVDWSGVGRAVIANVVSGAKAQGASTITMQVARNFYLSSEKSFIRKFYELMLTYKI 172
Cdd:TIGR02070  60 YDQISPNLKRAVIASEDAKFVEHHGFDWEAIQDALEKNEKSGKVVRGGSTISQQLAKNLFLWSGRSYLRKGLEAWATWML 139
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  173 EQNLSKDQILELYLNQIYLGHRSYGFAAASRTYYGKPLSEVSIAEAALLAGIPKAPSRFNPRANLKRAVARQHYVLDRME 252
Cdd:TIGR02070 140 ETWWSKQRILEVYLNSVEWGNGVFGAEAAARYYFKRSASNLTRGQAARLAAVLPNPKYYDENRPGPYVRRKATWILKQMG 219

                  ...
gi 754694470  253 KLG 255
Cdd:TIGR02070 220 YLG 222
FtsI COG0768
Cell division protein FtsI/penicillin-binding protein 2 [Cell cycle control, cell division, ...
452-742 1.46e-33

Cell division protein FtsI/penicillin-binding protein 2 [Cell cycle control, cell division, chromosome partitioning, Cell wall/membrane/envelope biogenesis];


Pssm-ID: 223839 [Multi-domain]  Cd Length: 599  Bit Score: 136.77  E-value: 1.46e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 452 GAFISLNPQNGAIESM-----------IGGFDFNRGD---FNRVTQAWRQPGSTFKPFVYAAGLERGvtpGTNISDQPFH 517
Cdd:COG0768  268 GAAVVLDPKTGEILAMasspsydpnlfVSSKDYDKPRkplLNRAVTGTYEPGSTFKPITAAAALETG---NTGLFDPGSV 344
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 518 LSAAQTRSKPWsPKNYGNSYSYSQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFD---------------PARQP 582
Cdd:COG0768  345 LDGNGPKIRIW-GRTGHDYGGRPLTLTEALQKSSNVGFAKLALRLGPDGLYDYLKKFGFGqktgidlpgetsgllPSREP 423
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 583 PK---SAYLTMALGAG-SVTPLQMASAYSVFANGGYRVNPYIIDSVVDiSTGRVIMKAQPamagdEANRVLDPRTAYVMN 658
Cdd:COG0768  424 WRwgpIDLATLSIGQGlLVTPLQLAQAYATIANGGKLVKPHLVKGIED-PVGENKKEPPV-----LKKRVISPETAEKVR 497
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 659 DLLRGVAKSGTAAR-TQATLKRGDIGGKTGT-----------TNQSYDAWFAGFTPKlvgiswlgfDQPK-------SLG 719
Cdd:COG0768  498 EGMRAVVNDGGGGTgKAAAVPGYRIAGKTGTaqkagpggggySKGRYHAWFVGFAPA---------DNPKyavavlvDNP 568
                        330       340
                 ....*....|....*....|...
gi 754694470 720 DKETGGGAAMPIWLSYMQTALKK 742
Cdd:COG0768  569 GGGYGGAVAAPVFKKIMERLLDY 591
pbp2_mrdA TIGR03423
penicillin-binding protein 2; Members of this protein family are penicillin-binding protein 2 ...
452-731 7.90e-27

penicillin-binding protein 2; Members of this protein family are penicillin-binding protein 2 (PBP-2), a protein whose gene (designated pbpA or mrdA) generally is found next to the gene for RodA, a protein required for rod (bacillus) shape in many bacteria. PBP-2 acts as a transpeptidase for cell elongation (hence, rod-shape). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]


Pssm-ID: 274573 [Multi-domain]  Cd Length: 592  Bit Score: 116.08  E-value: 7.90e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  452 GAFISLNPQNGAIESMIG--GFD---FNRG-----------D-----FNRVTQAWRQPGSTFKPFVYAAGLERGV-TPGT 509
Cdd:TIGR03423 249 GAVVVMDPRTGEILAMVStpSFDpnlFVDGisskdykallnDpdrplLNRAIQGVYPPGSTFKPVVALAALEEGViTPET 328
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  510 NISDqPFHLSAAQTRSKPWSPKNYGnsysySQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGF------D------ 577
Cdd:TIGR03423 329 RIYC-PGYFQLGGRRFRCWKRGGHG-----RVDLRKAIEESCDVYFYQLALRLGIDKIAEYAKRFGFgqktgiDlpgeks 402
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  578 ---PARQPPKSAY---------LTMALGAG--SVTPLQMASAYSVFANGGYRVNPYIIDSVVDiSTGRVIMKAQPAMAGD 643
Cdd:TIGR03423 403 glvPSREWKRKRFgqpwypgdtLNVSIGQGyvLVTPLQLAVATAALANGGKLYKPHLVKSIED-PDGGVVRRTEPEVLRP 481
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  644 eanRVLDPRTAYVMNDLLRGVAKS--GTAARTQATLKrGDIGGKTGT-------TNQSYD-----------AWFAGFTPk 703
Cdd:TIGR03423 482 ---LPISPENLDVVREGMRDVVNGpgGTARRARLGLP-YKMAGKTGTaqvvslkQGEKYDaeqiperlrdhALFVAFAP- 556
                         330       340       350
                  ....*....|....*....|....*....|...
gi 754694470  704 lvgiswlgFDQPK-----SLGDKETGGGAAMPI 731
Cdd:TIGR03423 557 --------YDNPKiavavIVEHGGGGSSAAAPI 581
spoVD_pbp TIGR02214
stage V sporulation protein D; This model describes the spoVD subfamily of homologs of the ...
426-747 4.06e-21

stage V sporulation protein D; This model describes the spoVD subfamily of homologs of the cell division protein FtsI, a penicillin binding protein. This subfamily is restricted to Bacillus subtilis and related Gram-positive species with known or suspected endospore formation capability. In these species, the functional equivalent of FtsI is desginated PBP-2B, a paralog of spoVD. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]


Pssm-ID: 131269 [Multi-domain]  Cd Length: 636  Bit Score: 98.35  E-value: 4.06e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  426 RIQRGSVIYLQKVDNTWTIINMptvegAFISLNPQNGAIESMIGGFDFNRGDF----------NRVTQAWRQPGSTFKPF 495
Cdd:TIGR02214 220 NIQYIIEREADKALRERKPKGV-----SIIVMNPKNGEILGMSNRPTYDPNDPrdkspdtarrNRAVSDAYEPGSTFKII 294
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  496 VYAAGLERGVTPGTNISDQPFHLSAAQTRSKPWSPKNYGnsysySQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFG 575
Cdd:TIGR02214 295 TSSAAMEEGIVKESDKFYDDGSATVGGKKIKCWKPGGHG-----SQTFPEVVQNSCNPGFIELGMRLGAEKLNNYILAFG 369
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  576 FD----------------PARQPPKSAYLTMALGAG-SVTPLQMASAYSVFANGGYRVNPYIIDSVVDISTGRVIMKAQP 638
Cdd:TIGR02214 370 FGsktgidlpgeaagilvPKKKVGPVDLATISFGQAnTVTPIQLMTAVNAVANGGKLIQPHIMKEISDSQNNAVDQTFEP 449
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  639 AMagdeANRVLDPRTAYVMNDLLRGVAKSGTAarTQATLKRGDIGGKTGTTNQ----------SYDAWFAGFTPK----- 703
Cdd:TIGR02214 450 EV----KRQVVSKETTQKLRLALETVVSKGSG--KNAFIEGYRVGGKTGTAQKvkpnggymegEYIVSFVGFAPAddpav 523
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*.
gi 754694470  704 --LVGIswlgfDQPKslGDKETGGGAAMPIWLSYMQTALKKVPVTP 747
Cdd:TIGR02214 524 avLVVV-----DNPK--GVQQFGGLVAAPVFGSVFNDILNYLGIKP 562
PCB_OB pfam17092
Penicillin-binding protein OB-like domain;
343-450 3.35e-17

Penicillin-binding protein OB-like domain;


Pssm-ID: 339884 [Multi-domain]  Cd Length: 111  Bit Score: 77.67  E-value: 3.35e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  343 YPGPAAQVDLPAGIENNTERFDLALEeirnKYRDSDDLVTAVVLSASASKVVAARTPEQIYELSGKSLGYVKRALTNS-- 420
Cdd:pfam17092   1 YRGPEAHLDLPADWAWDLAAIDDALK----DLPDVGGLRPAVVLSVSPKSATVGLADGETGTIPGDGLKWARPYLSDKrq 76
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 754694470  421 GPT----SRRIQRGSVIYLQKV-DNTWTIINMPTV 450
Cdd:pfam17092  77 GPApksaSDVLKPGDVIRVRKDgKGGWRLRQVPEV 111
PRK10795 PRK10795
penicillin-binding protein 2; Provisional
400-695 2.92e-07

penicillin-binding protein 2; Provisional


Pssm-ID: 236761 [Multi-domain]  Cd Length: 634  Bit Score: 54.00  E-value: 2.92e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 400 EQIYE--LSGKSlGYVKRALTNSGPTSRRI-----QRGSVIYLQKVDNTWTIIN--MPTVEGAFISLNPQNGAIESMI-- 468
Cdd:PRK10795 212 ERYYEdvLHGKT-GYEEVEVNNRGRVIRQLheqppQAGHDIYLTLDLKLQQYIEtlLAGSRAAVVVTDPRTGGILALVst 290
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 469 ---------GGF----------DFNRGDFNRVTQAWRQPGSTFKPFVYAAGLERGV-TPGTNISDqP--FHLSAAQTRSK 526
Cdd:PRK10795 291 psydpnlfvDGIsskdysgllnDPNRPLINRATQGVYPPASTVKPYVAVSALSAGViTRNTSLFD-PgwWQLPGSEKRYR 369
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 527 PWspKNYGNSysySQTMRQGLYKSKNMVSIRILQTVGPEFASEFISRFGFD---------------PARQPPKSAYL--- 588
Cdd:PRK10795 370 DW--KKWGHG---RLNVTKSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGhytgidlaeersgnmPTREWKQKRFKkpw 444
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 589 ----TMALGAG----SVTPLQMASAYSVFANGGYRVNPYIIDSVVDisTGRVIMKAQPamagdEANRVLDPRTAY--VMN 658
Cdd:PRK10795 445 yqgdTIPVGIGqgywTATPIQMSKALMTLINDGIVKVPHLLMSTAE--DGKQVPWVQP-----HEPPVGDIHSGYweIAK 517
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*.
gi 754694470 659 DLLRGVAK--SGTAARTQATLKRgDIGGKTGT-------TNQSYDA 695
Cdd:PRK10795 518 DGMYGVANrpNGTAHKYFASAPY-KIAAKSGTaqvfglkANETYNA 562
PRK15105 PRK15105
peptidoglycan synthase FtsI; Provisional
479-747 9.06e-05

peptidoglycan synthase FtsI; Provisional


Pssm-ID: 185060  Cd Length: 578  Bit Score: 45.58  E-value: 9.06e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 479 NRVTQAWRQPGSTFKPFVYAAGLERG-VTPGTNISDQPFHLSAAQTRskpwspknygNSYSYSQTMRQG-LYKSKNmVSI 556
Cdd:PRK15105 295 NRAITDVFEPGSTVKPMVVMTALQRGvVKENSVLNTVPYRINGHEIK----------DVARYSELTLTGvLQKSSN-VGV 363
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 557 RILQTVGPefASEFI---SRFGFDPARQ-----------PPKSAY-----LTMALGAG-SVTPLQMASAYSVFANGG-YR 615
Cdd:PRK15105 364 SKLALAMP--SSALVdtySRFGLGKATNlglvgersglyPQKQRWsdierATFSFGYGlMVTPLQLARVYATIGSYGiYR 441
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470 616 vnpyiidsvvDIStgrvIMKAQPAMAGDeanRVLDPRTAYVMNDLLRGVAKSGTAArTQATLKRGDIGGKTGTTNQ---- 691
Cdd:PRK15105 442 ----------PLS----ITKVDPPVPGE---RVFPESIVRTVVHMMESVALPGGGG-VKAAIKGYRIAIKTGTAKKvgpd 503
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 754694470 692 -----SYDAWFAGFTP------KLVGIswlgFDQPKslGDKETGGGAAMPIWLSYMQTALKKVPVTP 747
Cdd:PRK15105 504 gryinKYIAYTAGVAPasqprfALVVV----INDPQ--AGKYYGGAVSAPVFGAIMGGVLRTMNIEP 564
Glyco_hydro_70 pfam02324
Glycosyl hydrolase family 70; Members of this family belong to glycosyl hydrolase family 70 ...
360-415 1.81e-04

Glycosyl hydrolase family 70; Members of this family belong to glycosyl hydrolase family 70 Glucosyltransferases or sucrose 6-glycosyl transferases (GTF-S) catalyze the transfer of D-glucopyramnosyl units from sucrose onto acceptor molecules, EC:2.4.1.5. This family roughly corresponds to the N-terminal catalytic domain of the enzyme. Members of this family also contain the Putative cell wall binding domain pfam01473, which corresponds with the C-terminal glucan-binding domain.


Pssm-ID: 334895  Cd Length: 804  Bit Score: 44.97  E-value: 1.81e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 754694470  360 TERFDLALEEiRNKYRDSDDLVTAV-VLSASASKVVAARTPEQIYELSGKSLGYVKR 415
Cdd:pfam02324 623 TDRYDLGYSK-PNKYGTADDLRDAIkALHASGIQVIADWVPDQIYNLPEKEVVTATR 678
FAM216B pfam15107
FAM216B protein family; The function of this family of proteins, FAM216B, has not, as yet, ...
214-287 4.00e-03

FAM216B protein family; The function of this family of proteins, FAM216B, has not, as yet, been determined. Members of this family are as yet uncharacterized. This family of proteins are found in eukaryotes. Proteins in this family are approximately 150 amino acids in length. In humans, the gene encoding this protein is located in the position, C13orf30.


Pssm-ID: 317519  Cd Length: 103  Bit Score: 37.44  E-value: 4.00e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 754694470  214 SIAEAALLAGIPKAPSRF--------NPRAnLKRAVARQH-YVLDRMEKLGYITpeqHQEALAQKIVLRDNT-QETPETT 283
Cdd:pfam15107  22 SASDTSLLKDLTQGQQRYfysimkiyNSRP-QWEALKRRYmHSLQHQQLLGYIT---QHEALACAAVLRDSTkRASAKTA 97

                  ....
gi 754694470  284 FARH 287
Cdd:pfam15107  98 WRRT 101
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH