NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1368800975|gb|PSK38713|]
View 

hypothetical protein C7M61_002652 [[Candida] pseudohaemulonis]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
UBCc super family cl00154
Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain. This is part of the ...
26-161 6.96e-19

Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain. This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD.


The actual alignment was detected with superfamily member pfam05743:

Pssm-ID: 350921  Cd Length: 119  Bit Score: 82.31  E-value: 6.96e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  26 AYSHLYHFLAAYLTqgFKIRTAVYTSVLGHSQLLINLYGKLDC---GTCL-VPLNIWIPLNYPFqdenipalEPngvPVV 101
Cdd:pfam05743   1 TFKDLVNVLRKFPN--LKPRTDVYTFNDGSSKLLLNLYGTIPVtykGNTYnIPILIWLPDTYPF--------SP---PIC 67
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1368800975 102 FVVPEHGLMIRPNNNVDSQGRFYHPFMALW-HQNYtptaqtrdfSLLLLMSCLKITFEQNP 161
Cdd:pfam05743  68 YVKPTASMVIKVNHHVDAQGRVYLPYLHNWnHPSS---------NLVDLVQELAQVFQEDP 119
Vps23_core pfam09454
Vps23 core domain; ESCRT complexes form the main machinery driving protein sorting from ...
431-493 3.71e-13

Vps23 core domain; ESCRT complexes form the main machinery driving protein sorting from endosomes to lysosomes. The core domain of the Vps23 subunit of the heterotrimeric ESCRT-I complex is a helical hairpin sandwiched in a fan-like formation between two other helical hairpins from Vps28 (pfam03997) and Vps37. Vps23 gives ESCRT-I complex its stability.


:

Pssm-ID: 312827 [Multi-domain]  Cd Length: 60  Bit Score: 64.02  E-value: 3.71e-13
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1368800975 431 DIVTPDSILVNQLYDTVADIKAHKDTIDLVGGNFKGESelIndeNMDQCIKSVRGLARELFWL 493
Cdd:pfam09454   1 EIVVATTPLSNQLLELVAEDKAIEDTIYYLDRALDRGV--I---DLDTFLKQVRELAREQFLK 58
PHA03247 super family cl33720
large tegument protein UL36; Provisional
161-329 2.50e-05

large tegument protein UL36; Provisional


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 47.24  E-value: 2.50e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  161 PPLNTPPAAPPKVQPTNTGPQLPP--------------KMSYNETPVQLPT--PEPPRRETNGP-------PLPQKPLEA 217
Cdd:PHA03247  2826 GPLPPPTSAQPTAPPPPPGPPPPSlplggsvapggdvrRRPPSRSPAAKPAapARPPVRRLARPavsrsteSFALPPDQP 2905
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  218 QKPVEPQKPVEPQATQDSSIPEKYRMPLPLPPQDSPSPVPVQSPPQQRVPPPQVVYQDNSELYE-----PRRLRPQGPGK 292
Cdd:PHA03247  2906 ERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPgrvavPRFRVPQPAPS 2985
                          170       180       190
                   ....*....|....*....|....*....|....*..
gi 1368800975  293 PPNPRKAQTAKKPQGINEVEDLMDKVTLNENKGDRPI 329
Cdd:PHA03247  2986 REAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPV 3022
PRK04778 super family cl32064
septation ring formation regulator EzrA; Provisional
310-490 1.73e-03

septation ring formation regulator EzrA; Provisional


The actual alignment was detected with superfamily member PRK04778:

Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 40.59  E-value: 1.73e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 310 EVEDLMDKVTLNEN-------KGDRPILQMISDKINEFLASDESLVTAAPFVEQQKLKIEalenqllSHLKQAHANEENL 382
Cdd:PRK04778  257 EIQDLKEQIDENLAlleeldlDEAEEKNEEIQERIDQLYDILEREVKARKYVEKNSDTLP-------DFLEHAKEQNKEL 329
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 383 QNHITYVQ-------GQVESIRKLNVELQQVDQINAESKDEVAFGTGPGQKIKLEdivtpdsilVNQLYDTVADIKA-HK 454
Cdd:PRK04778  330 KEEIDRVKqsytlneSELESVRQLEKQLESLEKQYDEITERIAEQEIAYSELQEE---------LEEILKQLEEIEKeQE 400
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1368800975 455 DTIDLVGGNFKGESELinDENMDQCIKSVRGLAREL 490
Cdd:PRK04778  401 KLSEMLQGLRKDELEA--REKLERYRNKLHEIKRYL 434
 
Name Accession Description Interval E-value
UEV pfam05743
UEV domain; This family includes the eukaryotic tumor susceptibility gene 101 protein (TSG101). ...
26-161 6.96e-19

UEV domain; This family includes the eukaryotic tumor susceptibility gene 101 protein (TSG101). Altered transcripts of this gene have been detected in sporadic breast cancers and many other human malignancies. However, the involvement of this gene in neoplastic transformation and tumorigenesis is still elusive. TSG101 is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer. This family is related to the ubiquitin conjugating enzymes.


Pssm-ID: 310391  Cd Length: 119  Bit Score: 82.31  E-value: 6.96e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  26 AYSHLYHFLAAYLTqgFKIRTAVYTSVLGHSQLLINLYGKLDC---GTCL-VPLNIWIPLNYPFqdenipalEPngvPVV 101
Cdd:pfam05743   1 TFKDLVNVLRKFPN--LKPRTDVYTFNDGSSKLLLNLYGTIPVtykGNTYnIPILIWLPDTYPF--------SP---PIC 67
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1368800975 102 FVVPEHGLMIRPNNNVDSQGRFYHPFMALW-HQNYtptaqtrdfSLLLLMSCLKITFEQNP 161
Cdd:pfam05743  68 YVKPTASMVIKVNHHVDAQGRVYLPYLHNWnHPSS---------NLVDLVQELAQVFQEDP 119
Vps23_core pfam09454
Vps23 core domain; ESCRT complexes form the main machinery driving protein sorting from ...
431-493 3.71e-13

Vps23 core domain; ESCRT complexes form the main machinery driving protein sorting from endosomes to lysosomes. The core domain of the Vps23 subunit of the heterotrimeric ESCRT-I complex is a helical hairpin sandwiched in a fan-like formation between two other helical hairpins from Vps28 (pfam03997) and Vps37. Vps23 gives ESCRT-I complex its stability.


Pssm-ID: 312827 [Multi-domain]  Cd Length: 60  Bit Score: 64.02  E-value: 3.71e-13
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1368800975 431 DIVTPDSILVNQLYDTVADIKAHKDTIDLVGGNFKGESelIndeNMDQCIKSVRGLARELFWL 493
Cdd:pfam09454   1 EIVVATTPLSNQLLELVAEDKAIEDTIYYLDRALDRGV--I---DLDTFLKQVRELAREQFLK 58
PHA03247 PHA03247
large tegument protein UL36; Provisional
161-329 2.50e-05

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 47.24  E-value: 2.50e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  161 PPLNTPPAAPPKVQPTNTGPQLPP--------------KMSYNETPVQLPT--PEPPRRETNGP-------PLPQKPLEA 217
Cdd:PHA03247  2826 GPLPPPTSAQPTAPPPPPGPPPPSlplggsvapggdvrRRPPSRSPAAKPAapARPPVRRLARPavsrsteSFALPPDQP 2905
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  218 QKPVEPQKPVEPQATQDSSIPEKYRMPLPLPPQDSPSPVPVQSPPQQRVPPPQVVYQDNSELYE-----PRRLRPQGPGK 292
Cdd:PHA03247  2906 ERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPgrvavPRFRVPQPAPS 2985
                          170       180       190
                   ....*....|....*....|....*....|....*..
gi 1368800975  293 PPNPRKAQTAKKPQGINEVEDLMDKVTLNENKGDRPI 329
Cdd:PHA03247  2986 REAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPV 3022
GGN pfam15685
Gametogenetin; GGN is a family of proteins largely found in mammals. It reacts with POG in the ...
161-248 3.05e-04

Gametogenetin; GGN is a family of proteins largely found in mammals. It reacts with POG in the maturation of sperm and is expressed virtually only in the testis. It is found to be associated with the intracellular membrane, binds with GGNBP1 and may be involved in vesicular trafficking.


Pssm-ID: 317988 [Multi-domain]  Cd Length: 648  Bit Score: 43.11  E-value: 3.05e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 161 PPLNTPPAaPPKVQPTNTGPQLPPKMSYNETPVQLPTPEPPRRETNGPPLPQKPLEAQKPVE-----PQKPVEPQATQDS 235
Cdd:pfam15685 414 PPMFIFPA-PTNGEPVRPGPPGQQELPPMPPPVPPPTPQPPALQPTPLPVAPPPTPGPGHAEsalapPPAPALPPALAAD 492
                          90
                  ....*....|...
gi 1368800975 236 SIPEKYRMPLPLP 248
Cdd:pfam15685 493 QTPAPAPAPSPAP 505
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
310-490 1.73e-03

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 40.59  E-value: 1.73e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 310 EVEDLMDKVTLNEN-------KGDRPILQMISDKINEFLASDESLVTAAPFVEQQKLKIEalenqllSHLKQAHANEENL 382
Cdd:PRK04778  257 EIQDLKEQIDENLAlleeldlDEAEEKNEEIQERIDQLYDILEREVKARKYVEKNSDTLP-------DFLEHAKEQNKEL 329
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 383 QNHITYVQ-------GQVESIRKLNVELQQVDQINAESKDEVAFGTGPGQKIKLEdivtpdsilVNQLYDTVADIKA-HK 454
Cdd:PRK04778  330 KEEIDRVKqsytlneSELESVRQLEKQLESLEKQYDEITERIAEQEIAYSELQEE---------LEEILKQLEEIEKeQE 400
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1368800975 455 DTIDLVGGNFKGESELinDENMDQCIKSVRGLAREL 490
Cdd:PRK04778  401 KLSEMLQGLRKDELEA--REKLERYRNKLHEIKRYL 434
 
Name Accession Description Interval E-value
UEV pfam05743
UEV domain; This family includes the eukaryotic tumor susceptibility gene 101 protein (TSG101). ...
26-161 6.96e-19

UEV domain; This family includes the eukaryotic tumor susceptibility gene 101 protein (TSG101). Altered transcripts of this gene have been detected in sporadic breast cancers and many other human malignancies. However, the involvement of this gene in neoplastic transformation and tumorigenesis is still elusive. TSG101 is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer. This family is related to the ubiquitin conjugating enzymes.


Pssm-ID: 310391  Cd Length: 119  Bit Score: 82.31  E-value: 6.96e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  26 AYSHLYHFLAAYLTqgFKIRTAVYTSVLGHSQLLINLYGKLDC---GTCL-VPLNIWIPLNYPFqdenipalEPngvPVV 101
Cdd:pfam05743   1 TFKDLVNVLRKFPN--LKPRTDVYTFNDGSSKLLLNLYGTIPVtykGNTYnIPILIWLPDTYPF--------SP---PIC 67
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1368800975 102 FVVPEHGLMIRPNNNVDSQGRFYHPFMALW-HQNYtptaqtrdfSLLLLMSCLKITFEQNP 161
Cdd:pfam05743  68 YVKPTASMVIKVNHHVDAQGRVYLPYLHNWnHPSS---------NLVDLVQELAQVFQEDP 119
Vps23_core pfam09454
Vps23 core domain; ESCRT complexes form the main machinery driving protein sorting from ...
431-493 3.71e-13

Vps23 core domain; ESCRT complexes form the main machinery driving protein sorting from endosomes to lysosomes. The core domain of the Vps23 subunit of the heterotrimeric ESCRT-I complex is a helical hairpin sandwiched in a fan-like formation between two other helical hairpins from Vps28 (pfam03997) and Vps37. Vps23 gives ESCRT-I complex its stability.


Pssm-ID: 312827 [Multi-domain]  Cd Length: 60  Bit Score: 64.02  E-value: 3.71e-13
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1368800975 431 DIVTPDSILVNQLYDTVADIKAHKDTIDLVGGNFKGESelIndeNMDQCIKSVRGLARELFWL 493
Cdd:pfam09454   1 EIVVATTPLSNQLLELVAEDKAIEDTIYYLDRALDRGV--I---DLDTFLKQVRELAREQFLK 58
PHA03247 PHA03247
large tegument protein UL36; Provisional
161-329 2.50e-05

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 47.24  E-value: 2.50e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  161 PPLNTPPAAPPKVQPTNTGPQLPP--------------KMSYNETPVQLPT--PEPPRRETNGP-------PLPQKPLEA 217
Cdd:PHA03247  2826 GPLPPPTSAQPTAPPPPPGPPPPSlplggsvapggdvrRRPPSRSPAAKPAapARPPVRRLARPavsrsteSFALPPDQP 2905
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  218 QKPVEPQKPVEPQATQDSSIPEKYRMPLPLPPQDSPSPVPVQSPPQQRVPPPQVVYQDNSELYE-----PRRLRPQGPGK 292
Cdd:PHA03247  2906 ERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPgrvavPRFRVPQPAPS 2985
                          170       180       190
                   ....*....|....*....|....*....|....*..
gi 1368800975  293 PPNPRKAQTAKKPQGINEVEDLMDKVTLNENKGDRPI 329
Cdd:PHA03247  2986 REAPASSTPPLTGHSLSRVSSWASSLALHEETDPPPV 3022
PHA03247 PHA03247
large tegument protein UL36; Provisional
161-297 5.73e-05

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 46.08  E-value: 5.73e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  161 PPLNTPPAA-----PPKVQPTNTGPQLPPKMSYNETPVQLPTPEPPRRETNGPPLPQKPLEAQKPVEPQKPVEPQ-ATQD 234
Cdd:PHA03247  2556 PPAAPPAAPdrsvpPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSpSPAA 2635
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1368800975  235 SSIPEKYRMPLPLPPQDSPSPVPVQSPPQQRVPPPQVVYQDNSELYEPRR-------------LRPQGPGKPPNPR 297
Cdd:PHA03247  2636 NEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRraarptvgsltslADPPPPPPTPEPA 2711
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
161-249 1.03e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 44.80  E-value: 1.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 161 PPLNTPPA--APPKVQPTnTGPQLPPKmsyneTPVQLPTPE-PPRRETNGPPLPQKPLEAQKPVEPQKPVEPQATQDSSI 237
Cdd:PRK14950  365 APQPAKPTaaAPSPVRPT-PAPSTRPK-----AAAAANIPPkEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPV 438
                          90
                  ....*....|..
gi 1368800975 238 PEKYRMPLPLPP 249
Cdd:PRK14950  439 DEKPKYTPPAPP 450
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
161-339 1.08e-04

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 44.68  E-value: 1.08e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 161 PPLNTPPAAP--PKVQPTNTGPQLPPKMSYNETPVQLPTPEPPR--RETNGPPLPQKPLEAQKPVEPQKPVEPQATQDSS 236
Cdd:PTZ00449  573 PTLSKKPEFPkdPKHPKDPEEPKKPKRPRSAQRPTRPKSPKLPEllDIPKSPKRPESPKSPKRPPPPQRPSSPERPEGPK 652
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 237 IPEKYRMPL-PLPPQD-------------------SPSPVPVQSPPQQRVPPPQVVYQDNSELYEPRRL---RPQGPGKP 293
Cdd:PTZ00449  653 IIKSPKPPKsPKPPFDpkfkekfyddyldaaakskETKTTVVLDESFESILKETLPETPGTPFTTPRPLppkLPRDEEFP 732
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 1368800975 294 PNPRKAQTAKKPQGINEVEDLMDKVT-LNENKGDRPILQMISDKINE 339
Cdd:PTZ00449  733 FEPIGDPDAEQPDDIEFFTPPEEERTfFHETPADTPLPDILAEEFKE 779
GGN pfam15685
Gametogenetin; GGN is a family of proteins largely found in mammals. It reacts with POG in the ...
161-248 3.05e-04

Gametogenetin; GGN is a family of proteins largely found in mammals. It reacts with POG in the maturation of sperm and is expressed virtually only in the testis. It is found to be associated with the intracellular membrane, binds with GGNBP1 and may be involved in vesicular trafficking.


Pssm-ID: 317988 [Multi-domain]  Cd Length: 648  Bit Score: 43.11  E-value: 3.05e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 161 PPLNTPPAaPPKVQPTNTGPQLPPKMSYNETPVQLPTPEPPRRETNGPPLPQKPLEAQKPVE-----PQKPVEPQATQDS 235
Cdd:pfam15685 414 PPMFIFPA-PTNGEPVRPGPPGQQELPPMPPPVPPPTPQPPALQPTPLPVAPPPTPGPGHAEsalapPPAPALPPALAAD 492
                          90
                  ....*....|...
gi 1368800975 236 SIPEKYRMPLPLP 248
Cdd:pfam15685 493 QTPAPAPAPSPAP 505
PHA03247 PHA03247
large tegument protein UL36; Provisional
161-246 4.88e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 43.00  E-value: 4.88e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  161 PPLNTPPAAPPKVQPTNTGPQLPPK-MSYNETPVQLPTPEPPRRETNGPPLPQKPLEAQKPVEPQKPVEPQATQDSSIPE 239
Cdd:PHA03247   380 LPTRKRRSARHAATPFARGPGGDDQtRPAAPVPASVPTPAPTPVPASAPPPPATPLPSAEPGSDDGPAPPPERQPPAPAT 459

                   ....*..
gi 1368800975  240 KYRMPLP 246
Cdd:PHA03247   460 EPAPDDP 466
PHA02682 PHA02682
ORF080 virion core protein; Provisional
161-248 9.36e-04

ORF080 virion core protein; Provisional


Pssm-ID: 177464 [Multi-domain]  Cd Length: 280  Bit Score: 41.00  E-value: 9.36e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 161 PPLNTPPAAPPKVQPTNT----GPQLPPKMSYN-ETPVQLPTPEPP--------RRETNGPPLP-QKPLEAQKPVEPQKP 226
Cdd:PHA02682   91 PAPACPACAPAAPAPAVTcpapAPACPPATAPTcPPPAVCPAPARPapacppstRQCPPAPPLPtPKPAPAAKPIFLHNQ 170
                          90       100
                  ....*....|....*....|..
gi 1368800975 227 VEPQATQDSSIPEKYRMPLPLP 248
Cdd:PHA02682  171 LPPPDYPAASCPTIETAPAASP 192
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
310-490 1.73e-03

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 40.59  E-value: 1.73e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 310 EVEDLMDKVTLNEN-------KGDRPILQMISDKINEFLASDESLVTAAPFVEQQKLKIEalenqllSHLKQAHANEENL 382
Cdd:PRK04778  257 EIQDLKEQIDENLAlleeldlDEAEEKNEEIQERIDQLYDILEREVKARKYVEKNSDTLP-------DFLEHAKEQNKEL 329
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 383 QNHITYVQ-------GQVESIRKLNVELQQVDQINAESKDEVAFGTGPGQKIKLEdivtpdsilVNQLYDTVADIKA-HK 454
Cdd:PRK04778  330 KEEIDRVKqsytlneSELESVRQLEKQLESLEKQYDEITERIAEQEIAYSELQEE---------LEEILKQLEEIEKeQE 400
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1368800975 455 DTIDLVGGNFKGESELinDENMDQCIKSVRGLAREL 490
Cdd:PRK04778  401 KLSEMLQGLRKDELEA--REKLERYRNKLHEIKRYL 434
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
161-250 2.42e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 40.47  E-value: 2.42e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 161 PPLNTPPAAPPKVQPTNTGPQLPPKMSYNEtPVQLPTPEPPRRETNGPPLPQKPLE--AQKPVEPQKPVEPQATQDSSIP 238
Cdd:PRK14951  384 PEAAAPAAAPVAQAAAAPAPAAAPAAAASA-PAAPPAAAPPAPVAAPAAAAPAAAPaaAPAAVALAPAPPAQAAPETVAI 462
                          90
                  ....*....|..
gi 1368800975 239 EKYRMPLPLPPQ 250
Cdd:PRK14951  463 PVRVAPEPAVAS 474
PHA03247 PHA03247
large tegument protein UL36; Provisional
158-249 2.78e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.31  E-value: 2.78e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  158 EQNPPLNTPPAAPPKVQPTNTGPQLPPKmsyNETPvqLPTPEPPrrETNGPPLPQKPLEAQKPVEPQKPVEPQATQDSSI 237
Cdd:PHA03247   403 DQTRPAAPVPASVPTPAPTPVPASAPPP---PATP--LPSAEPG--SDDGPAPPPERQPPAPATEPAPDDPDDATRKALD 475
                           90
                   ....*....|..
gi 1368800975  238 PEKYRMPlPLPP 249
Cdd:PHA03247   476 ALRERRP-PEPP 486
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
161-305 3.18e-03

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 335243 [Multi-domain]  Cd Length: 980  Bit Score: 40.00  E-value: 3.18e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 161 PPLNTPPAAPPKVQPTNTGPQLPPKMSYNET--PVQ-LPTPEPPRRETNGPPLPQKPLEAQKPVEPQKPVEPQATQDSSI 237
Cdd:pfam03154 183 SPPPGPQTQVATPAPTPSAPSLPSQVSPPTTqpPLQpLPVASPHTLIQQTPTLHPQRLPSPHPPLQPMPDPPSQVSPQSA 262
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 238 PEKY----------------RMPLPLPPQDSPSPVPVQSPPQQRVPPPQVVYQDNSELYEPRRLRPQGPGKPPNPRKAQT 301
Cdd:pfam03154 263 PQPGlhgpmppmphslqgpsHLPHPGPPQPFGQGQVPPPPSLQAPHPSQLQHTPPSQSQGPSPQPPREQPLPPAPLSMPH 342

                  ....
gi 1368800975 302 AKKP 305
Cdd:pfam03154 343 IKPP 346
TALPID3 pfam15324
Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for ...
161-226 3.27e-03

Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for Hedgehog signalling. Mutations in this gene noticed first in chickens lead to multiple abnormalities of development.


Pssm-ID: 317697 [Multi-domain]  Cd Length: 1241  Bit Score: 40.21  E-value: 3.27e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1368800975  161 PPLNTPPAAP----------PKVQPTNTGPQLPPKMSYNeTPVQLPTPEPPRRETNGPPLPQKPLEAQKPVEPQKP 226
Cdd:pfam15324  959 SPVKTPDSSPcpsehdgafpVKEIPAEKGADGPAVTPVI-TPTVTPVATPPPAATPSPPLSENSIDKLKSPSPELP 1033
PRK11633 PRK11633
cell division protein DedD; Provisional
161-226 4.62e-03

cell division protein DedD; Provisional


Pssm-ID: 236940 [Multi-domain]  Cd Length: 226  Bit Score: 38.45  E-value: 4.62e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1368800975 161 PPLNTPPAAPPKVQPTntgPQLPPKMsyneTPVQLPTPEPPRRETNGPPLPQKPleAQKPVEPQKP 226
Cdd:PRK11633   87 PATVAPPNTPVEPEPA---PVEPPKP----KPVEKPKPKPKPQQKVEAPPAPKP--EPKPVVEEKA 143
PHA03247 PHA03247
large tegument protein UL36; Provisional
165-249 5.28e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 39.54  E-value: 5.28e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975  165 TPPAAPPKVQPTNTGPQLPPkmsynetpvQLPTPEP-PRRETNGPPLPQKPLEAQK--PVEPQKPVEPQATQDSSIPEKY 241
Cdd:PHA03247  2684 RRRAARPTVGSLTSLADPPP---------PPPTPEPaPHALVSATPLPPGPAAARQasPALPAAPAPPAVPAGPATPGGP 2754

                   ....*...
gi 1368800975  242 RMPlPLPP 249
Cdd:PHA03247  2755 ARP-ARPP 2761
DUF4654 pfam15547
Domain of unknown function (DUF4654); This family of proteins is found in eukaryotes. Proteins ...
132-236 7.37e-03

Domain of unknown function (DUF4654); This family of proteins is found in eukaryotes. Proteins in this family are typically between 145 and 169 amino acids in length. There is a conserved IDC sequence motif.


Pssm-ID: 317881  Cd Length: 137  Bit Score: 36.71  E-value: 7.37e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 132 HQNYTPTAQtrdfsLLLLMSClkiTFEQNPPLNTPPAaPPKVQPTNTGPQLPPKMSY------NETPVQLPTP------- 198
Cdd:pfam15547   2 HQKAIPTAH-----LTFVIDC---ARGKQLSLAAPPA-PPRAPSPNRGPVTPPMKTYivfcgeNQPHLTQEAPlgggcla 72
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 1368800975 199 -----EPPRRETNGP-PLPQKPLEAQKPVEPQ-KPVEPQATQDSS 236
Cdd:pfam15547  73 qargtLPPCRGTVAPaSSPVSPLCPQEAPEAKgSPLKAGPTRSSA 117
PRK08691 PRK08691
DNA polymerase III subunits gamma and tau; Validated
144-251 9.25e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236333 [Multi-domain]  Cd Length: 709  Bit Score: 38.54  E-value: 9.25e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1368800975 144 FSLLLLMSCLKITFEQNPPLNTPPAAPPKVQPTNTGPQLPPKMSYNETPVQLP----------TPEPPRRETN--GPPLP 211
Cdd:PRK08691  358 FAPLAAASCDANAVIENTELQSPSAQTAEKETAAKKPQPRPEAETAQTPVQTAsaaampsegkTAGPVSNQENndVPPWE 437
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1368800975 212 QKPLEAQKPV--------------EPQKPVEPQATQDSSIPEKYRMPLPLPPQD 251
Cdd:PRK08691  438 DAPDEAQTAAgtaqtsaksiqtasEAETPPENQVSKNKAADNETDAPLSEVPSE 491
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH