NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|28872817|ref|NP_057852|]
View 

Vpr [Human immunodeficiency virus 1]

Protein Classification

Vpr/Vpx protein (domain architecture ID 10455195)

Vpr/Vpx protein is involved in virus replication

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
VPR pfam00522
VPR/VPX protein;
1-82 1.51e-34

VPR/VPX protein;


:

Pssm-ID: 278923  Cd Length: 83  Bit Score: 113.25  E-value: 1.51e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28872817    1 MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSR 80
Cdd:pfam00522  1 RERVPEGEEPQREPFDEWLDETLEEIKEEAVKHFPRELLFQVWQYIYEYWGDEQGGAYRYIRLLQKALFVHFRAGCRHSR 80

                 ..
gi 28872817   81 IG 82
Cdd:pfam00522 81 IG 82
 
Name Accession Description Interval E-value
VPR pfam00522
VPR/VPX protein;
1-82 1.51e-34

VPR/VPX protein;


Pssm-ID: 278923  Cd Length: 83  Bit Score: 113.25  E-value: 1.51e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28872817    1 MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSR 80
Cdd:pfam00522  1 RERVPEGEEPQREPFDEWLDETLEEIKEEAVKHFPRELLFQVWQYIYEYWGDEQGGAYRYIRLLQKALFVHFRAGCRHSR 80

                 ..
gi 28872817   81 IG 82
Cdd:pfam00522 81 IG 82
 
Name Accession Description Interval E-value
VPR pfam00522
VPR/VPX protein;
1-82 1.51e-34

VPR/VPX protein;


Pssm-ID: 278923  Cd Length: 83  Bit Score: 113.25  E-value: 1.51e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28872817    1 MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSR 80
Cdd:pfam00522  1 RERVPEGEEPQREPFDEWLDETLEEIKEEAVKHFPRELLFQVWQYIYEYWGDEQGGAYRYIRLLQKALFVHFRAGCRHSR 80

                 ..
gi 28872817   81 IG 82
Cdd:pfam00522 81 IG 82
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH