NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|31981304|ref|NP_038505|]
View 

V-type proton ATPase subunit d 1 [Mus musculus]

Protein Classification

V-type ATPase subunit (domain architecture ID 10488051)

V-type ATPase subunit such as Enterococcus hirae V-type sodium ATPase subunit C that is involved in ATP-driven sodium extrusion, and eukaryotic V-type proton ATPase subunit d that is part of the integral membrane V0 proton pore complex of vacuolar ATPase, which is responsible for acidifying a variety of intracellular compartments in cells and providing the energy required for transport in the vacuolar system

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
vATP-synt_AC39 pfam01992
ATP synthase (C/AC39) subunit; This family includes the AC39 subunit from vacuolar ATP ...
16-344 1.23e-104

ATP synthase (C/AC39) subunit; This family includes the AC39 subunit from vacuolar ATP synthase, and the C subunit from archaebacterial ATP synthase. The family also includes subunit C from the Sodium transporting ATP synthase from Enterococcus hirae.


:

Pssm-ID: 396538  Cd Length: 333  Bit Score: 310.36  E-value: 1.23e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    16 LEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLAS 95
Cdd:pfam01992   1 LNARVRAMESKLLTEEDYERLLQCESLEEAARYLKETGYGDFLADEESPLHRGDIEKALRRELAKTFEKLRRFAPGLSRE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    96 FLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSF--EQMEAVNIAQTPAELYNAILvDTPLAAFFQDCISEQDl 173
Cdd:pfam01992  81 FLDLYLYRYDIHNLKLLLRGKLSGLDLEELLEFLIPLGTLsaLDLDKLIEAKDVEELPEALL-GTPYAEALEEALDELE- 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   174 DEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFG-TELSKEDRAKLFPHCGRLYPEGL 252
Cdd:pfam01992 159 ETGDLQLIENALDKAYYEDLYKFCKKLGGKTAEILREYLGFEIDLRNIKIILRSKKyGKLSPEEIYKLLIPGGSLSPEEL 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   253 AQLARADDYEQVKNVADYYPeYKLLFEGAGSNPGD--KTLEDRFFEHEVKLNK-LAFLNQFHFGVFYAFVKLKEQECRNI 329
Cdd:pfam01992 239 KALAEAEDVEEVLAALEGTP-YGELLSEALEELTGslSALERALDRYLLELAKkLARYQPFSIGPILAYLKLKEQEIRNL 317
                         330
                  ....*....|....*.
gi 31981304   330 VWIAECIAQR-HRAKI 344
Cdd:pfam01992 318 RIIAEGKRYGlPPEEI 333
 
Name Accession Description Interval E-value
vATP-synt_AC39 pfam01992
ATP synthase (C/AC39) subunit; This family includes the AC39 subunit from vacuolar ATP ...
16-344 1.23e-104

ATP synthase (C/AC39) subunit; This family includes the AC39 subunit from vacuolar ATP synthase, and the C subunit from archaebacterial ATP synthase. The family also includes subunit C from the Sodium transporting ATP synthase from Enterococcus hirae.


Pssm-ID: 396538  Cd Length: 333  Bit Score: 310.36  E-value: 1.23e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    16 LEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLAS 95
Cdd:pfam01992   1 LNARVRAMESKLLTEEDYERLLQCESLEEAARYLKETGYGDFLADEESPLHRGDIEKALRRELAKTFEKLRRFAPGLSRE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    96 FLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSF--EQMEAVNIAQTPAELYNAILvDTPLAAFFQDCISEQDl 173
Cdd:pfam01992  81 FLDLYLYRYDIHNLKLLLRGKLSGLDLEELLEFLIPLGTLsaLDLDKLIEAKDVEELPEALL-GTPYAEALEEALDELE- 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   174 DEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFG-TELSKEDRAKLFPHCGRLYPEGL 252
Cdd:pfam01992 159 ETGDLQLIENALDKAYYEDLYKFCKKLGGKTAEILREYLGFEIDLRNIKIILRSKKyGKLSPEEIYKLLIPGGSLSPEEL 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   253 AQLARADDYEQVKNVADYYPeYKLLFEGAGSNPGD--KTLEDRFFEHEVKLNK-LAFLNQFHFGVFYAFVKLKEQECRNI 329
Cdd:pfam01992 239 KALAEAEDVEEVLAALEGTP-YGELLSEALEELTGslSALERALDRYLLELAKkLARYQPFSIGPILAYLKLKEQEIRNL 317
                         330
                  ....*....|....*.
gi 31981304   330 VWIAECIAQR-HRAKI 344
Cdd:pfam01992 318 RIIAEGKRYGlPPEEI 333
NtpC COG1527
Archaeal/vacuolar-type H+-ATPase subunit C/Vma6 [Energy production and conversion];
14-350 2.89e-57

Archaeal/vacuolar-type H+-ATPase subunit C/Vma6 [Energy production and conversion];


Pssm-ID: 224444  Cd Length: 346  Bit Score: 189.10  E-value: 2.89e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304  14 GYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASpLTVSVIDDKLKEKMVVEFRHMRNHAYEPL 93
Cdd:COG1527  10 AYPNARIRVMEARLLTDEQYSELLEAESLEEFARVLEETDYKEDLDSLTS-LGPDLLEKALNRKLVDTYRLILRISPGSI 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304  94 ASFLDFITYSYMIDNVILLITGTLHQRSiAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEqdL 173
Cdd:COG1527  89 KKLIDAYLYKWDIENIKTLLRAKLAGDP-EEISDLLIPLGDFETLLTLAEAKTMEEVVETLEGTTYLAPLEEALRDY--E 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304 174 DEMNIEIIRNTLYKAYLESFYKFCTLLGGttADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLA 253
Cdd:COG1527 166 DTGDIEPLENALDKAYYEDLLRSVNSEKG--DELLREFLRLEIDRRNIKTALRGKASELSEELMESLIPDGGSLDASALR 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304 254 QLARADDYEQVKN------VADYYPEYKLLFEGAGSnpgdKTLEDRFFEHEVKLNKLAFLNQFHFGVF--YAFVKLKEQE 325
Cdd:COG1527 244 DLAEAEDILDVLEalegtsYGDALSEYREEYEEGGS----IAVFEEALRKALLKRAKEFAQYYPLSVGpvLAYLLRKEIE 319
                       330       340
                ....*....|....*....|....*.
gi 31981304 326 CRNIVWIAECIAQ-RHRAKIDNYIPI 350
Cdd:COG1527 320 VKNLRWIAEGKANgLPREEIKELLVP 345
AhaC TIGR02923
ATP synthase A1, C subunit; The A1/A0 ATP synthase is homologous to the V-type (V1/V0, ...
15-333 1.21e-11

ATP synthase A1, C subunit; The A1/A0 ATP synthase is homologous to the V-type (V1/V0, vacuolar) ATPase, but functions in the ATP synthetic direction as does the F1/F0 ATPase of bacteria. The C subunit is part of the hydrophilic A1 "stalk" complex (AhaABCDEFG), which is the site of ATP generation and is coupled to the membrane-embedded proton translocating A0 complex.


Pssm-ID: 274352  Cd Length: 343  Bit Score: 64.77  E-value: 1.21e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    15 YLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLT-VSVIDDKLKEKMVVEFRHMRNHAYEPL 93
Cdd:TIGR02923   7 YPNARVRAMESRLLKEEDFNELLEMRGTDEIVRFLEETDYKKELDELGSKSYgVDLIEHALDANLAKTYEKLFRISPGAS 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    94 ASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSF--EQMEAVNIAQTPAELYNAiLVDTPLAAFFQDCISEQ 171
Cdd:TIGR02923  87 RDLIRLYLKKWDVWNIKTLIRAKYANASAEEVEDLLIPAGEFleKRIKELAEAKTIEEIVEA-LEGTPYYGPLQEALAGN 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   172 DldemNIEIIRNTLYKAYLESFYKfctLLGGTTADAMCPILEF---EADRRAFIITINSFGTELSKEDRAKLF-PHCGRL 247
Cdd:TIGR02923 166 G----DLSPIENELDRMYYEKLLK---YVGSPSDDETKLFTEFiktEVDIRNLKTLLRLKAAGLSPDEIMPYTiPGGYEL 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   248 YPEGLAQLARADDYEQVKNVADYYpEYKLLFEGAGSNPGDK--TLEDRFFEHEVKL-NKLAFLNQFHFGVFYAFVKLKEQ 324
Cdd:TIGR02923 239 DEEKLAPLAHIESIDEVVSALDGT-KYGEDISEVLSEEEKSvaVFERALDEYLIKMaTKLSLRYPLSVGPVLGYILKKER 317

                  ....*....
gi 31981304   325 ECRNIVWIA 333
Cdd:TIGR02923 318 EVRNLRAIA 326
PRK01198 PRK01198
V-type ATP synthase subunit C; Provisional
20-346 1.11e-09

V-type ATP synthase subunit C; Provisional


Pssm-ID: 234917  Cd Length: 352  Bit Score: 59.12  E-value: 1.11e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   20 VRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLT-VSVIDDKLKEKMVVEFRHMRNHAYEPLASFLD 98
Cdd:PRK01198  18 VRVREAKLLDREKYERLLEMKSLEEIIRFLEETEYKEEIDELGSRYSgPDLIEKALNRNLAKTYELLLEISPGRLKELVD 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   99 FITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSF--EQMEAVNIAQTPAELYNaILVDT----PLAAFFQDCISEQD 172
Cdd:PRK01198  98 VYLRKWDIHNIKTLLRGKILGLDAEEIEELLIPAGELdlEKLKELLEAKSVEEIVK-ILEGTeyyeVLEEALEDYEETGD 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304  173 LDEMNIEiirntLYKAYLESFYKFCTLLGGTTAdamcPILEF---EADRRAFIITINSFGTELSKEDRAKLFPHCGRLYP 249
Cdd:PRK01198 177 LQPIENA-----LDKYYYENLLEIASPKDIDEK----LLLEYvrtEIDITNIKTLLRLKAQGLSADFIEKVLIPGGSLDE 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304  250 EGLAQLArADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDrfFEHEVK---LNKLAFLNQFH-FGV--FYAFVKLKE 323
Cdd:PRK01198 248 EKLKELL-AEDIEELVSALEGTKYGDVLSEALEEYEETGSLSV--FEKALDnylLEYMKKLSKRYpFSVepILGYILAKE 324
                        330       340
                 ....*....|....*....|...
gi 31981304  324 QECRNIVWIAeciaqrhRAKIDN 346
Cdd:PRK01198 325 REVKNLRIIA-------RGKENG 340
 
Name Accession Description Interval E-value
vATP-synt_AC39 pfam01992
ATP synthase (C/AC39) subunit; This family includes the AC39 subunit from vacuolar ATP ...
16-344 1.23e-104

ATP synthase (C/AC39) subunit; This family includes the AC39 subunit from vacuolar ATP synthase, and the C subunit from archaebacterial ATP synthase. The family also includes subunit C from the Sodium transporting ATP synthase from Enterococcus hirae.


Pssm-ID: 396538  Cd Length: 333  Bit Score: 310.36  E-value: 1.23e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    16 LEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLAS 95
Cdd:pfam01992   1 LNARVRAMESKLLTEEDYERLLQCESLEEAARYLKETGYGDFLADEESPLHRGDIEKALRRELAKTFEKLRRFAPGLSRE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    96 FLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSF--EQMEAVNIAQTPAELYNAILvDTPLAAFFQDCISEQDl 173
Cdd:pfam01992  81 FLDLYLYRYDIHNLKLLLRGKLSGLDLEELLEFLIPLGTLsaLDLDKLIEAKDVEELPEALL-GTPYAEALEEALDELE- 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   174 DEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFG-TELSKEDRAKLFPHCGRLYPEGL 252
Cdd:pfam01992 159 ETGDLQLIENALDKAYYEDLYKFCKKLGGKTAEILREYLGFEIDLRNIKIILRSKKyGKLSPEEIYKLLIPGGSLSPEEL 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   253 AQLARADDYEQVKNVADYYPeYKLLFEGAGSNPGD--KTLEDRFFEHEVKLNK-LAFLNQFHFGVFYAFVKLKEQECRNI 329
Cdd:pfam01992 239 KALAEAEDVEEVLAALEGTP-YGELLSEALEELTGslSALERALDRYLLELAKkLARYQPFSIGPILAYLKLKEQEIRNL 317
                         330
                  ....*....|....*.
gi 31981304   330 VWIAECIAQR-HRAKI 344
Cdd:pfam01992 318 RIIAEGKRYGlPPEEI 333
NtpC COG1527
Archaeal/vacuolar-type H+-ATPase subunit C/Vma6 [Energy production and conversion];
14-350 2.89e-57

Archaeal/vacuolar-type H+-ATPase subunit C/Vma6 [Energy production and conversion];


Pssm-ID: 224444  Cd Length: 346  Bit Score: 189.10  E-value: 2.89e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304  14 GYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASpLTVSVIDDKLKEKMVVEFRHMRNHAYEPL 93
Cdd:COG1527  10 AYPNARIRVMEARLLTDEQYSELLEAESLEEFARVLEETDYKEDLDSLTS-LGPDLLEKALNRKLVDTYRLILRISPGSI 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304  94 ASFLDFITYSYMIDNVILLITGTLHQRSiAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEqdL 173
Cdd:COG1527  89 KKLIDAYLYKWDIENIKTLLRAKLAGDP-EEISDLLIPLGDFETLLTLAEAKTMEEVVETLEGTTYLAPLEEALRDY--E 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304 174 DEMNIEIIRNTLYKAYLESFYKFCTLLGGttADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLA 253
Cdd:COG1527 166 DTGDIEPLENALDKAYYEDLLRSVNSEKG--DELLREFLRLEIDRRNIKTALRGKASELSEELMESLIPDGGSLDASALR 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304 254 QLARADDYEQVKN------VADYYPEYKLLFEGAGSnpgdKTLEDRFFEHEVKLNKLAFLNQFHFGVF--YAFVKLKEQE 325
Cdd:COG1527 244 DLAEAEDILDVLEalegtsYGDALSEYREEYEEGGS----IAVFEEALRKALLKRAKEFAQYYPLSVGpvLAYLLRKEIE 319
                       330       340
                ....*....|....*....|....*.
gi 31981304 326 CRNIVWIAECIAQ-RHRAKIDNYIPI 350
Cdd:COG1527 320 VKNLRWIAEGKANgLPREEIKELLVP 345
AhaC TIGR02923
ATP synthase A1, C subunit; The A1/A0 ATP synthase is homologous to the V-type (V1/V0, ...
15-333 1.21e-11

ATP synthase A1, C subunit; The A1/A0 ATP synthase is homologous to the V-type (V1/V0, vacuolar) ATPase, but functions in the ATP synthetic direction as does the F1/F0 ATPase of bacteria. The C subunit is part of the hydrophilic A1 "stalk" complex (AhaABCDEFG), which is the site of ATP generation and is coupled to the membrane-embedded proton translocating A0 complex.


Pssm-ID: 274352  Cd Length: 343  Bit Score: 64.77  E-value: 1.21e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    15 YLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLT-VSVIDDKLKEKMVVEFRHMRNHAYEPL 93
Cdd:TIGR02923   7 YPNARVRAMESRLLKEEDFNELLEMRGTDEIVRFLEETDYKKELDELGSKSYgVDLIEHALDANLAKTYEKLFRISPGAS 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304    94 ASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSF--EQMEAVNIAQTPAELYNAiLVDTPLAAFFQDCISEQ 171
Cdd:TIGR02923  87 RDLIRLYLKKWDVWNIKTLIRAKYANASAEEVEDLLIPAGEFleKRIKELAEAKTIEEIVEA-LEGTPYYGPLQEALAGN 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   172 DldemNIEIIRNTLYKAYLESFYKfctLLGGTTADAMCPILEF---EADRRAFIITINSFGTELSKEDRAKLF-PHCGRL 247
Cdd:TIGR02923 166 G----DLSPIENELDRMYYEKLLK---YVGSPSDDETKLFTEFiktEVDIRNLKTLLRLKAAGLSPDEIMPYTiPGGYEL 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   248 YPEGLAQLARADDYEQVKNVADYYpEYKLLFEGAGSNPGDK--TLEDRFFEHEVKL-NKLAFLNQFHFGVFYAFVKLKEQ 324
Cdd:TIGR02923 239 DEEKLAPLAHIESIDEVVSALDGT-KYGEDISEVLSEEEKSvaVFERALDEYLIKMaTKLSLRYPLSVGPVLGYILKKER 317

                  ....*....
gi 31981304   325 ECRNIVWIA 333
Cdd:TIGR02923 318 EVRNLRAIA 326
PRK01198 PRK01198
V-type ATP synthase subunit C; Provisional
20-346 1.11e-09

V-type ATP synthase subunit C; Provisional


Pssm-ID: 234917  Cd Length: 352  Bit Score: 59.12  E-value: 1.11e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   20 VRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLT-VSVIDDKLKEKMVVEFRHMRNHAYEPLASFLD 98
Cdd:PRK01198  18 VRVREAKLLDREKYERLLEMKSLEEIIRFLEETEYKEEIDELGSRYSgPDLIEKALNRNLAKTYELLLEISPGRLKELVD 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304   99 FITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSF--EQMEAVNIAQTPAELYNaILVDT----PLAAFFQDCISEQD 172
Cdd:PRK01198  98 VYLRKWDIHNIKTLLRGKILGLDAEEIEELLIPAGELdlEKLKELLEAKSVEEIVK-ILEGTeyyeVLEEALEDYEETGD 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304  173 LDEMNIEiirntLYKAYLESFYKFCTLLGGTTAdamcPILEF---EADRRAFIITINSFGTELSKEDRAKLFPHCGRLYP 249
Cdd:PRK01198 177 LQPIENA-----LDKYYYENLLEIASPKDIDEK----LLLEYvrtEIDITNIKTLLRLKAQGLSADFIEKVLIPGGSLDE 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31981304  250 EGLAQLArADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDrfFEHEVK---LNKLAFLNQFH-FGV--FYAFVKLKE 323
Cdd:PRK01198 248 EKLKELL-AEDIEELVSALEGTKYGDVLSEALEEYEETGSLSV--FEKALDnylLEYMKKLSKRYpFSVepILGYILAKE 324
                        330       340
                 ....*....|....*....|...
gi 31981304  324 QECRNIVWIAeciaqrhRAKIDN 346
Cdd:PRK01198 325 REVKNLRIIA-------RGKENG 340
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH