NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|934113350|gb|KPL86016|]
View 

hypothetical protein SE18_14085 [Herpetosiphon geysericola]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CBM_2 pfam00553
Cellulose binding domain; Two tryptophan residues are involved in cellulose binding. Cellulose ...
504-603 6.78e-35

Cellulose binding domain; Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.


:

Pssm-ID: 334140  Cd Length: 101  Bit Score: 127.16  E-value: 6.78e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  504 CQITYTISNQWGNGFTADVSIRNNGSA-INNWNVAWTFAGNQQITNLWNGVVSQSGQNVSVTSAGWNGSIASGGTASFGF 582
Cdd:pfam00553   1 CTATYAVTNQWGTGFTANVTITNTGSSpINGWTVSWTYPAGQRVTQSWNATVSGSGNPVTATNVSWNGTIAPGGSASFGF 80
                          90       100
                  ....*....|....*....|.
gi 934113350  583 QGTYSGSNAKPSSISLNGTAC 603
Cdd:pfam00553  81 NGSGTGSNSAPTSFTVNGAAC 101
Glyco_hydro_8 super family cl01351
Glycosyl hydrolases family 8;
54-418 1.97e-33

Glycosyl hydrolases family 8;


The actual alignment was detected with superfamily member pfam01270:

Pssm-ID: 294813  Cd Length: 321  Bit Score: 130.03  E-value: 1.97e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350   54 QAWNEWKSNMITANNagggnrlRVMG-GVDNSSTVSEGQGYGMLFASLFDDQNTLDGLWLFTSDHLDP--NGLMHWHIGN 130
Cdd:pfam01270   6 LEWEQFKSAYITSNG-------RVQDtGNTNYSTTSEGQGYGMLLAVYAGDRAAFDNLWRWTQVNLNQtsNGLFSWRIDK 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  131 PGQLRG---SYAATDGDEDMALGLLNACVKvrkgvWQpsSNGLDYCGLATTMINNIYTYEVDhPGSSPvaglpnnqgneL 207
Cdd:pfam01270  79 SGNIPVkdsKNNATDGDVLIAWSLLFAGKK-----WQ--SGRYNYITDAKNKIINIYNKMVE-AGTYV-----------L 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  208 LPGDGWNLARDYPegIVNLSYFSPGYFtVFGKFTGkTSQWEAVNSRNYEItnLAQSRPGNcSKLVPNWNQYDGDAqlvSW 287
Cdd:pfam01270 140 LPGAVGFGKNNSV--ILNPSYFAPAWY-QFADRTG-NPGWRQVAEDCYRL--VDEARFGQ-TGLPPDWCAANATG---AS 209
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  288 QPEeyAWWSYDAARFAWRVAVDKAWYNTASSRETmNEVGGFFsSVGIENVQARYRMNGTSVDNYRGVFFVANAaaaiwaa 367
Cdd:pfam01270 210 GQA--FDWPYRFSYDAIRVPLYYYWYGTAAKTKC-DALSNFF-KIGWANIKDGYTPSWVDVSSGHTATYNSPA------- 278
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|.
gi 934113350  368 paaqavncGAATGTLKTSPQQAYNMVLATKDAPNSYYVNAWRLMSMLLLTG 418
Cdd:pfam01270 279 --------GALAVTDTTYANNIAGELVDLKDASYDYYSNTLRLLVLLARTG 321
PRK13042 super family cl32851
superantigen-like protein SSL4; Reviewed;
414-495 1.58e-05

superantigen-like protein SSL4; Reviewed;


The actual alignment was detected with superfamily member PRK13042:

Pssm-ID: 183854 [Multi-domain]  Cd Length: 291  Bit Score: 46.93  E-value: 1.58e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 414 LLLTGNFPNIYELANGVTPTSTPLPTNTTVPATNTPVPTNVLPTNTTVPATNT----PVPTNVLPTNTTVPTIR-PTNTP 488
Cdd:PRK13042  15 LLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKVEAPQSKPNATTPPSTKVeapqQTPNATTPSSTKVETPQsPTTKQ 94

                 ....*..
gi 934113350 489 VPTSVPP 495
Cdd:PRK13042  95 VPTEINP 101
 
Name Accession Description Interval E-value
CBM_2 pfam00553
Cellulose binding domain; Two tryptophan residues are involved in cellulose binding. Cellulose ...
504-603 6.78e-35

Cellulose binding domain; Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.


Pssm-ID: 334140  Cd Length: 101  Bit Score: 127.16  E-value: 6.78e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  504 CQITYTISNQWGNGFTADVSIRNNGSA-INNWNVAWTFAGNQQITNLWNGVVSQSGQNVSVTSAGWNGSIASGGTASFGF 582
Cdd:pfam00553   1 CTATYAVTNQWGTGFTANVTITNTGSSpINGWTVSWTYPAGQRVTQSWNATVSGSGNPVTATNVSWNGTIAPGGSASFGF 80
                          90       100
                  ....*....|....*....|.
gi 934113350  583 QGTYSGSNAKPSSISLNGTAC 603
Cdd:pfam00553  81 NGSGTGSNSAPTSFTVNGAAC 101
Glyco_hydro_8 pfam01270
Glycosyl hydrolases family 8;
54-418 1.97e-33

Glycosyl hydrolases family 8;


Pssm-ID: 279594  Cd Length: 321  Bit Score: 130.03  E-value: 1.97e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350   54 QAWNEWKSNMITANNagggnrlRVMG-GVDNSSTVSEGQGYGMLFASLFDDQNTLDGLWLFTSDHLDP--NGLMHWHIGN 130
Cdd:pfam01270   6 LEWEQFKSAYITSNG-------RVQDtGNTNYSTTSEGQGYGMLLAVYAGDRAAFDNLWRWTQVNLNQtsNGLFSWRIDK 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  131 PGQLRG---SYAATDGDEDMALGLLNACVKvrkgvWQpsSNGLDYCGLATTMINNIYTYEVDhPGSSPvaglpnnqgneL 207
Cdd:pfam01270  79 SGNIPVkdsKNNATDGDVLIAWSLLFAGKK-----WQ--SGRYNYITDAKNKIINIYNKMVE-AGTYV-----------L 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  208 LPGDGWNLARDYPegIVNLSYFSPGYFtVFGKFTGkTSQWEAVNSRNYEItnLAQSRPGNcSKLVPNWNQYDGDAqlvSW 287
Cdd:pfam01270 140 LPGAVGFGKNNSV--ILNPSYFAPAWY-QFADRTG-NPGWRQVAEDCYRL--VDEARFGQ-TGLPPDWCAANATG---AS 209
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  288 QPEeyAWWSYDAARFAWRVAVDKAWYNTASSRETmNEVGGFFsSVGIENVQARYRMNGTSVDNYRGVFFVANAaaaiwaa 367
Cdd:pfam01270 210 GQA--FDWPYRFSYDAIRVPLYYYWYGTAAKTKC-DALSNFF-KIGWANIKDGYTPSWVDVSSGHTATYNSPA------- 278
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|.
gi 934113350  368 paaqavncGAATGTLKTSPQQAYNMVLATKDAPNSYYVNAWRLMSMLLLTG 418
Cdd:pfam01270 279 --------GALAVTDTTYANNIAGELVDLKDASYDYYSNTLRLLVLLARTG 321
CBD_II smart00637
CBD_II domain;
511-602 2.37e-26

CBD_II domain;


Pssm-ID: 214754  Cd Length: 92  Bit Score: 102.87  E-value: 2.37e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350   511 SNQWGNGFTADVSIRNNGS-AINNWNVAWTFAGNQQITNLWNGVVSQSGQNVSVTSAGWNGSIASGGTASFGFQGtYSGS 589
Cdd:smart00637   1 TSDWGSGFTANVTVTNTGSsAINGWTLTFDLPGGQTVTNSWNATVSQSGGHVTATNASWNGTIAPGGSVSFGFQG-KTGS 79
                           90
                   ....*....|...
gi 934113350   590 NAKPSSISLNGTA 602
Cdd:smart00637  80 SAAPTGFTLNGAA 92
BcsZ COG3405
Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism];
55-335 7.50e-15

Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism];


Pssm-ID: 225940  Cd Length: 360  Bit Score: 76.06  E-value: 7.50e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  55 AWNEWKSNMItanNAGGgnrlRVMGGVDNSS-TVSEGQGYGMLFASLFDDQNTLDGLWLFTSDHL----DPNGLMHWHIG 129
Cdd:COG3405   28 AWEQYKKDFI---SQEG----RVIDPSGNRKiTTSEGQSYGMFFAVLADDKDAFDRIWNWTQNNLaqgsLKDGLFAWLWG 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 130 N--PGQLRGSYAATDGDEDMALGLLNAcvkvrKGVWqpssNGLDYCGLATTMINNIYTYEVdHPGSSPvaglpnnqGNEL 207
Cdd:COG3405  101 PkeKGHVLDSNNATDGDIWIAYALLEA-----SRLW----KDQDYTEFSYALAKRILKEEV-VNVPGL--------GSLL 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 208 LPGDGWNLARDYPegIVNLSYFSPGYFTVFGKFTGKTSQWEAVNSRNYEITNLAQSRpgncsKLVPNWNQYDGD-AQLVS 286
Cdd:COG3405  163 LPAKNGFIEANSW--RFNPSYLPPHLFQYFSLWFGEPDWKEALRETNQILLLETAPT-----GLSPDWVRYEGKpGQLKG 235
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 934113350 287 WQPEeyawWSYDAARFAWRVAVDKAWY-NTASSRETMNEVGGFFSSVGIE 335
Cdd:COG3405  236 EKTF----ISSDAIRVYLYAGMMADGDpQLLRMLNRFKGMATFTAKKGYP 281
CelA1 COG5297
Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism];
481-586 1.93e-08

Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism];


Pssm-ID: 227616 [Multi-domain]  Cd Length: 544  Bit Score: 56.98  E-value: 1.93e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 481 TIRPTNTPVPTSVPPTNTpiagacQITYTISNQWGNGFTADVSIRNNGSAINNWNVAWTFAGnqQITNLWNGVVSQSGQN 560
Cdd:COG5297  447 SSSSGSSSSPNPDPTKNI------TSSITVDSDWHTGYCERVKVTNTGSSRSSWTVTIPLKG--TIQTLWSATWSLSGDK 518
                         90       100
                 ....*....|....*....|....*.
gi 934113350 561 VSVTSAGWNGSIASGGTASFGFQGTY 586
Cdd:COG5297  519 LIASGLDWNKTLEPNGTTEFGFCANY 544
PRK11097 PRK11097
endo-1,4-D-glucanase; Provisional
55-301 2.47e-08

endo-1,4-D-glucanase; Provisional


Pssm-ID: 236844  Cd Length: 376  Bit Score: 56.10  E-value: 2.47e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  55 AWNEWKSNMITANNagggnrlRVmggVDNSS----TVSEGQGYGMLFASLFDDQNTLDGLWLFTSDHL---DPNG-LMHW 126
Cdd:PRK11097  27 AWEQFKKDYISADG-------RV---IDPSDarkiTTSEGQSYGLFFALVANDRAAFDKLLNWTENNLaqgDLTArLPAW 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 127 HIGNPGQlrGSY------AATDGDEDMALGLLNAcvkvrkG-VWQPSSngldYCGLATTMINNIYTYEV-DHPGSSPVag 198
Cdd:PRK11097  97 LWGKKAD--GTWgvldanSASDADLWIAYSLLEA------GrLWKEPR----YTALGTALLKRIAREEVvTVPGLGSM-- 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 199 lpnnqgneLLPGD-GWNLARDYpegIVNLSYFSPGYFTVFGKFTGKtSQWEAVNSRNYEITnLAQSRPGncskLVPNWNQ 277
Cdd:PRK11097 163 --------LLPGPvGFADDGSW---RLNPSYLPPQLLRRFARFLPG-GPWAALAATNARLL-LETAPKG----FSPDWVR 225
                        250       260
                 ....*....|....*....|....*.
gi 934113350 278 YDGDAQlvsWQPEEY--AWWSYDAAR 301
Cdd:PRK11097 226 YQKGKG---FQPDPEkgDIGSYDAIR 248
PRK13042 PRK13042
superantigen-like protein SSL4; Reviewed;
414-495 1.58e-05

superantigen-like protein SSL4; Reviewed;


Pssm-ID: 183854 [Multi-domain]  Cd Length: 291  Bit Score: 46.93  E-value: 1.58e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 414 LLLTGNFPNIYELANGVTPTSTPLPTNTTVPATNTPVPTNVLPTNTTVPATNT----PVPTNVLPTNTTVPTIR-PTNTP 488
Cdd:PRK13042  15 LLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKVEAPQSKPNATTPPSTKVeapqQTPNATTPSSTKVETPQsPTTKQ 94

                 ....*..
gi 934113350 489 VPTSVPP 495
Cdd:PRK13042  95 VPTEINP 101
Lamp pfam01299
Lysosome-associated membrane glycoprotein (Lamp);
421-517 1.88e-05

Lysosome-associated membrane glycoprotein (Lamp);


Pssm-ID: 334479  Cd Length: 314  Bit Score: 46.91  E-value: 1.88e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  421 PNIYELANGVTPTSTPLPTNTTVPATNTPVPTNVLPTNTTVPATNTPVPTnvlptnTTVPTIRPTNTPVPTSVPPTNTPI 500
Cdd:pfam01299  39 NTTYRCLSPSQIEMSNVTSTFSDVTTQAYTSNGTTSKQETTCSTDSPTTT------TATTNTTSTTTPTPTPPTPTPTPP 112
                          90
                  ....*....|....*..
gi 934113350  501 AGACQITYTISNqwGNG 517
Cdd:pfam01299 113 SSPTVGNYSVTN--GSG 127
 
Name Accession Description Interval E-value
CBM_2 pfam00553
Cellulose binding domain; Two tryptophan residues are involved in cellulose binding. Cellulose ...
504-603 6.78e-35

Cellulose binding domain; Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.


Pssm-ID: 334140  Cd Length: 101  Bit Score: 127.16  E-value: 6.78e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  504 CQITYTISNQWGNGFTADVSIRNNGSA-INNWNVAWTFAGNQQITNLWNGVVSQSGQNVSVTSAGWNGSIASGGTASFGF 582
Cdd:pfam00553   1 CTATYAVTNQWGTGFTANVTITNTGSSpINGWTVSWTYPAGQRVTQSWNATVSGSGNPVTATNVSWNGTIAPGGSASFGF 80
                          90       100
                  ....*....|....*....|.
gi 934113350  583 QGTYSGSNAKPSSISLNGTAC 603
Cdd:pfam00553  81 NGSGTGSNSAPTSFTVNGAAC 101
Glyco_hydro_8 pfam01270
Glycosyl hydrolases family 8;
54-418 1.97e-33

Glycosyl hydrolases family 8;


Pssm-ID: 279594  Cd Length: 321  Bit Score: 130.03  E-value: 1.97e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350   54 QAWNEWKSNMITANNagggnrlRVMG-GVDNSSTVSEGQGYGMLFASLFDDQNTLDGLWLFTSDHLDP--NGLMHWHIGN 130
Cdd:pfam01270   6 LEWEQFKSAYITSNG-------RVQDtGNTNYSTTSEGQGYGMLLAVYAGDRAAFDNLWRWTQVNLNQtsNGLFSWRIDK 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  131 PGQLRG---SYAATDGDEDMALGLLNACVKvrkgvWQpsSNGLDYCGLATTMINNIYTYEVDhPGSSPvaglpnnqgneL 207
Cdd:pfam01270  79 SGNIPVkdsKNNATDGDVLIAWSLLFAGKK-----WQ--SGRYNYITDAKNKIINIYNKMVE-AGTYV-----------L 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  208 LPGDGWNLARDYPegIVNLSYFSPGYFtVFGKFTGkTSQWEAVNSRNYEItnLAQSRPGNcSKLVPNWNQYDGDAqlvSW 287
Cdd:pfam01270 140 LPGAVGFGKNNSV--ILNPSYFAPAWY-QFADRTG-NPGWRQVAEDCYRL--VDEARFGQ-TGLPPDWCAANATG---AS 209
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  288 QPEeyAWWSYDAARFAWRVAVDKAWYNTASSRETmNEVGGFFsSVGIENVQARYRMNGTSVDNYRGVFFVANAaaaiwaa 367
Cdd:pfam01270 210 GQA--FDWPYRFSYDAIRVPLYYYWYGTAAKTKC-DALSNFF-KIGWANIKDGYTPSWVDVSSGHTATYNSPA------- 278
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|.
gi 934113350  368 paaqavncGAATGTLKTSPQQAYNMVLATKDAPNSYYVNAWRLMSMLLLTG 418
Cdd:pfam01270 279 --------GALAVTDTTYANNIAGELVDLKDASYDYYSNTLRLLVLLARTG 321
CBD_II smart00637
CBD_II domain;
511-602 2.37e-26

CBD_II domain;


Pssm-ID: 214754  Cd Length: 92  Bit Score: 102.87  E-value: 2.37e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350   511 SNQWGNGFTADVSIRNNGS-AINNWNVAWTFAGNQQITNLWNGVVSQSGQNVSVTSAGWNGSIASGGTASFGFQGtYSGS 589
Cdd:smart00637   1 TSDWGSGFTANVTVTNTGSsAINGWTLTFDLPGGQTVTNSWNATVSQSGGHVTATNASWNGTIAPGGSVSFGFQG-KTGS 79
                           90
                   ....*....|...
gi 934113350   590 NAKPSSISLNGTA 602
Cdd:smart00637  80 SAAPTGFTLNGAA 92
BcsZ COG3405
Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism];
55-335 7.50e-15

Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism];


Pssm-ID: 225940  Cd Length: 360  Bit Score: 76.06  E-value: 7.50e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  55 AWNEWKSNMItanNAGGgnrlRVMGGVDNSS-TVSEGQGYGMLFASLFDDQNTLDGLWLFTSDHL----DPNGLMHWHIG 129
Cdd:COG3405   28 AWEQYKKDFI---SQEG----RVIDPSGNRKiTTSEGQSYGMFFAVLADDKDAFDRIWNWTQNNLaqgsLKDGLFAWLWG 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 130 N--PGQLRGSYAATDGDEDMALGLLNAcvkvrKGVWqpssNGLDYCGLATTMINNIYTYEVdHPGSSPvaglpnnqGNEL 207
Cdd:COG3405  101 PkeKGHVLDSNNATDGDIWIAYALLEA-----SRLW----KDQDYTEFSYALAKRILKEEV-VNVPGL--------GSLL 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 208 LPGDGWNLARDYPegIVNLSYFSPGYFTVFGKFTGKTSQWEAVNSRNYEITNLAQSRpgncsKLVPNWNQYDGD-AQLVS 286
Cdd:COG3405  163 LPAKNGFIEANSW--RFNPSYLPPHLFQYFSLWFGEPDWKEALRETNQILLLETAPT-----GLSPDWVRYEGKpGQLKG 235
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 934113350 287 WQPEeyawWSYDAARFAWRVAVDKAWY-NTASSRETMNEVGGFFSSVGIE 335
Cdd:COG3405  236 EKTF----ISSDAIRVYLYAGMMADGDpQLLRMLNRFKGMATFTAKKGYP 281
CelA1 COG5297
Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism];
481-586 1.93e-08

Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism];


Pssm-ID: 227616 [Multi-domain]  Cd Length: 544  Bit Score: 56.98  E-value: 1.93e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 481 TIRPTNTPVPTSVPPTNTpiagacQITYTISNQWGNGFTADVSIRNNGSAINNWNVAWTFAGnqQITNLWNGVVSQSGQN 560
Cdd:COG5297  447 SSSSGSSSSPNPDPTKNI------TSSITVDSDWHTGYCERVKVTNTGSSRSSWTVTIPLKG--TIQTLWSATWSLSGDK 518
                         90       100
                 ....*....|....*....|....*.
gi 934113350 561 VSVTSAGWNGSIASGGTASFGFQGTY 586
Cdd:COG5297  519 LIASGLDWNKTLEPNGTTEFGFCANY 544
PRK11097 PRK11097
endo-1,4-D-glucanase; Provisional
55-301 2.47e-08

endo-1,4-D-glucanase; Provisional


Pssm-ID: 236844  Cd Length: 376  Bit Score: 56.10  E-value: 2.47e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  55 AWNEWKSNMITANNagggnrlRVmggVDNSS----TVSEGQGYGMLFASLFDDQNTLDGLWLFTSDHL---DPNG-LMHW 126
Cdd:PRK11097  27 AWEQFKKDYISADG-------RV---IDPSDarkiTTSEGQSYGLFFALVANDRAAFDKLLNWTENNLaqgDLTArLPAW 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 127 HIGNPGQlrGSY------AATDGDEDMALGLLNAcvkvrkG-VWQPSSngldYCGLATTMINNIYTYEV-DHPGSSPVag 198
Cdd:PRK11097  97 LWGKKAD--GTWgvldanSASDADLWIAYSLLEA------GrLWKEPR----YTALGTALLKRIAREEVvTVPGLGSM-- 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 199 lpnnqgneLLPGD-GWNLARDYpegIVNLSYFSPGYFTVFGKFTGKtSQWEAVNSRNYEITnLAQSRPGncskLVPNWNQ 277
Cdd:PRK11097 163 --------LLPGPvGFADDGSW---RLNPSYLPPQLLRRFARFLPG-GPWAALAATNARLL-LETAPKG----FSPDWVR 225
                        250       260
                 ....*....|....*....|....*.
gi 934113350 278 YDGDAQlvsWQPEEY--AWWSYDAAR 301
Cdd:PRK11097 226 YQKGKG---FQPDPEkgDIGSYDAIR 248
PRK13042 PRK13042
superantigen-like protein SSL4; Reviewed;
414-495 1.58e-05

superantigen-like protein SSL4; Reviewed;


Pssm-ID: 183854 [Multi-domain]  Cd Length: 291  Bit Score: 46.93  E-value: 1.58e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 414 LLLTGNFPNIYELANGVTPTSTPLPTNTTVPATNTPVPTNVLPTNTTVPATNT----PVPTNVLPTNTTVPTIR-PTNTP 488
Cdd:PRK13042  15 LLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKVEAPQSKPNATTPPSTKVeapqQTPNATTPSSTKVETPQsPTTKQ 94

                 ....*..
gi 934113350 489 VPTSVPP 495
Cdd:PRK13042  95 VPTEINP 101
Lamp pfam01299
Lysosome-associated membrane glycoprotein (Lamp);
421-517 1.88e-05

Lysosome-associated membrane glycoprotein (Lamp);


Pssm-ID: 334479  Cd Length: 314  Bit Score: 46.91  E-value: 1.88e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  421 PNIYELANGVTPTSTPLPTNTTVPATNTPVPTNVLPTNTTVPATNTPVPTnvlptnTTVPTIRPTNTPVPTSVPPTNTPI 500
Cdd:pfam01299  39 NTTYRCLSPSQIEMSNVTSTFSDVTTQAYTSNGTTSKQETTCSTDSPTTT------TATTNTTSTTTPTPTPPTPTPTPP 112
                          90
                  ....*....|....*..
gi 934113350  501 AGACQITYTISNqwGNG 517
Cdd:pfam01299 113 SSPTVGNYSVTN--GSG 127
PHA03291 PHA03291
envelope glycoprotein I; Provisional
432-502 5.56e-05

envelope glycoprotein I; Provisional


Pssm-ID: 223033  Cd Length: 401  Bit Score: 45.72  E-value: 5.56e-05
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 934113350 432 PTSTPL--PTNTTVPATNTPVPTNVLPTNTTVP--ATNTPVPTNVLPTNTTVPTIRPTNTPVPTSVPPTNTPIAG 502
Cdd:PHA03291 191 PLSAPRlgPADVFVPATPRPTPRTTASPETTPTpsTTTSPPSTTIPAPSTTIAAPQAGTTPEAEGTPAPPTPGGG 265
MGC-24 pfam05283
Multi-glycosylated core protein 24 (MGC-24), sialomucin; This family consists of several ...
439-495 1.99e-04

Multi-glycosylated core protein 24 (MGC-24), sialomucin; This family consists of several MGC-24 (or Cd164 antigen) proteins from eukaryotic organisms. MGC-24/CD164 is a sialomucin expressed in many normal and cancerous tissues. In humans, soluble and transmembrane forms of MGC-24 are produced by alternative splicing.


Pssm-ID: 310122  Cd Length: 140  Bit Score: 41.73  E-value: 1.99e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 934113350  439 TNTTVPATNTPVPTNVLPTNTTVPATNTPVPTNVLPTNttvptirPTNTPVPTSVPP 495
Cdd:pfam05283  50 EFCSVASTTTPKPTNSTAKTTTLPSSTTTSTTVATTGT-------PNTTPTPTSQPT 99
PRK11907 PRK11907
bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; ...
411-524 2.39e-04

bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed


Pssm-ID: 237019 [Multi-domain]  Cd Length: 814  Bit Score: 44.07  E-value: 2.39e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 411 MSMLLLTGNFPniyeLANGVTPTSTPLPTNTTVPATNTPVPTnvlPTNTTVPATNTPVPTNVLPTNTTVPTIRPTNTPVP 490
Cdd:PRK11907  13 LTLALLTASNP----KLAQAEEIVTTTPATSTEAEQTTPVES---DATEEADNTETPVAATTAAEAPSSSETAETSDPTS 85
                         90       100       110
                 ....*....|....*....|....*....|....
gi 934113350 491 TSVPPTNTPIAGACQITyTISNQWGNGFTADVSI 524
Cdd:PRK11907  86 EATDTTTSEARTVTPAA-TETSKPVEGQTVDVRI 118
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
425-496 5.76e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 42.98  E-value: 5.76e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  425 ELANGVTPTSTPLPTNTT-VPATNTPVPTNVLPT----------NTTVPATNTPVPTNVLPT-NTTVPTIRPTN------ 486
Cdd:pfam05109 505 DMTSPTSAVTTPTPNATSpTPAVTTPTPNATSPTlgktsptsavTTPTPNATSPTPAVTTPTpNATIPTLGKTSptsavt 584
                          90
                  ....*....|
gi 934113350  487 TPVPTSVPPT 496
Cdd:pfam05109 585 TPTPNATSPT 594
MGC-24 pfam05283
Multi-glycosylated core protein 24 (MGC-24), sialomucin; This family consists of several ...
430-488 6.89e-04

Multi-glycosylated core protein 24 (MGC-24), sialomucin; This family consists of several MGC-24 (or Cd164 antigen) proteins from eukaryotic organisms. MGC-24/CD164 is a sialomucin expressed in many normal and cancerous tissues. In humans, soluble and transmembrane forms of MGC-24 are produced by alternative splicing.


Pssm-ID: 310122  Cd Length: 140  Bit Score: 40.18  E-value: 6.89e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  430 VTPTSTPLPTNTTVPATNTPVPTNvlpTNTTVPATNTPvptnvlptNTTV-PTIRPTNTP 488
Cdd:pfam05283  54 VASTTTPKPTNSTAKTTTLPSSTT---TSTTVATTGTP--------NTTPtPTSQPTHKS 102
PRK14948 PRK14948
DNA polymerase III subunits gamma and tau; Provisional
415-497 8.08e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237862 [Multi-domain]  Cd Length: 620  Bit Score: 42.26  E-value: 8.08e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 415 LLTG--NFPNIYELANGVTPTSTPLPTNTTVPATNTPVPTNVLPTNTTVPATNTPVPTNVLPTNTTVPTIRPTNTPVPTS 492
Cdd:PRK14948 355 TLLGllPSAFISEIANASAPANPTPAPNPSPPPAPIQPSAPKTKQAATTPSPPPAKASPPIPVPAEPTEPSPTPPANAAN 434

                 ....*
gi 934113350 493 VPPTN 497
Cdd:PRK14948 435 APPSL 439
PRK10856 PRK10856
cytoskeletal protein RodZ; Provisional
433-501 1.13e-03

cytoskeletal protein RodZ; Provisional


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 41.17  E-value: 1.13e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 934113350 433 TSTPLPTNTTVPATNTPVPTNVL---PTNTTVPATNTPVPTNVLPTNTTVPTirPTNTPVPTSVPPTNTPIA 501
Cdd:PRK10856 160 QSVPLDTSTTTDPATTPAPAAPVdttPTNSQTPAVATAPAPAVDPQQNAVVA--PSQANVDTAATPAPAAPA 229
MGC-24 pfam05283
Multi-glycosylated core protein 24 (MGC-24), sialomucin; This family consists of several ...
457-500 1.88e-03

Multi-glycosylated core protein 24 (MGC-24), sialomucin; This family consists of several MGC-24 (or Cd164 antigen) proteins from eukaryotic organisms. MGC-24/CD164 is a sialomucin expressed in many normal and cancerous tissues. In humans, soluble and transmembrane forms of MGC-24 are produced by alternative splicing.


Pssm-ID: 310122  Cd Length: 140  Bit Score: 38.64  E-value: 1.88e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 934113350  457 TNTTVPATNTPVPTNVLPTNTTVPTIRPTNTPVPTSVPPTNTPI 500
Cdd:pfam05283  50 EFCSVASTTTPKPTNSTAKTTTLPSSTTTSTTVATTGTPNTTPT 93
PRK10856 PRK10856
cytoskeletal protein RodZ; Provisional
431-521 2.17e-03

cytoskeletal protein RodZ; Provisional


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 40.39  E-value: 2.17e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 431 TPTSTPLPTNTTVPATNTPVPTNVLPTNTTVPA---TNTPVPTNVLPTNTTVPTirpTNTPVPTSVPPTNTPIAGACQIT 507
Cdd:PRK10856 179 AAPVDTTPTNSQTPAVATAPAPAVDPQQNAVVApsqANVDTAATPAPAAPATPD---GAAPLPTDQAGVSTPAADPNALV 255
                         90
                 ....*....|....
gi 934113350 508 YTisnqwgngFTAD 521
Cdd:PRK10856 256 MN--------FTAD 261
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
373-501 3.37e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 40.18  E-value: 3.37e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 373 VNCGAATGTLKTSPQQAYNMVLATKDAPNSYYVNAWRLMSML---LLTGNFPNI-YELA---NGVTPTSTPLPTNTTVPA 445
Cdd:PRK14950 296 LNSGADRSLLDLTADEKAALQKVSQIANLEALTKWVKAFSQLdfqLRTTSYGQLpLELAvieALLVPVPAPQPAKPTAAA 375
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350 446 TN--TPVPTNVLPTNTTVPATNTPVPTNVLPTNTTVPTIRPTNTPVPTS--VPPTNTPIA 501
Cdd:PRK14950 376 PSpvRPTPAPSTRPKAAAAANIPPKEPVRETATPPPVPPRPVAPPVPHTpeSAPKLTRAA 435
AJAP1_PANP_C pfam15298
AJAP1/PANP C-terminus; This family includes the C-terminus of adherens junction-associated ...
420-511 3.97e-03

AJAP1/PANP C-terminus; This family includes the C-terminus of adherens junction-associated protein 1 (AJAP1) and of PILR-associating neural protein (PANP). AJAP1 inhibits cell adhesion and migration. PANP is a ligand for the immune inhibitory receptor paired immunoglobulin-like type 2 receptor alpha.


Pssm-ID: 317671  Cd Length: 200  Bit Score: 38.73  E-value: 3.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  420 FPNIYElangvtPTSTPLPTNTTVPATNTPVPTNVLPTNTTVPATNTPVPTNVLPTNTTVPTIRPTNTPVPTSVPPTNTP 499
Cdd:pfam15298  17 FPGIYG------STRVSTTTTTATTTTTTTRTTTRTTTVTTQPPGLGPGRNEPGRLSTTEPSAGHGKTAKPPRPLGDTSG 90
                          90
                  ....*....|..
gi 934113350  500 IAGACQITYTIS 511
Cdd:pfam15298  91 LAVHQIITITVS 102
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
427-503 5.55e-03

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904 [Multi-domain]  Cd Length: 886  Bit Score: 39.51  E-value: 5.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 934113350  427 ANGVTPTSTPLPTNTTVPATNTPVPTNVLPTNTtvPATNTPVPTNVLPT-NTTVPTIRPTN------TPVPTSVPPT--- 496
Cdd:pfam05109 485 ASPVTPSPSPRDNGTESKAPDMTSPTSAVTTPT--PNATSPTPAVTTPTpNATSPTLGKTSptsavtTPTPNATSPTpav 562

                  ....*..
gi 934113350  497 NTPIAGA 503
Cdd:pfam05109 563 TTPTPNA 569
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH