Conserved Protein Domain Family

pfam11187: DUF2974 
Protein of unknown function (DUF2974)
This bacterial family of proteins has no known function.
PSSM-Id: 402661
Aligned: 15 rows
Threshold Bit Score: 289.592
Threshold Setting Gi: 122266499
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_003807625  157 SAYRYVNSILDRSEGflssgdspA-VMLGGHSKGGNMAVYAAMRiAHDDIEvagerarrlgllpslggpvrgrnrRISRI 235 Bifidobacteriu...
Q74KR9        143 FARSYYRKIKNLFSG--------K-FYLGGHSKGGNLAFAVALNlKESDLS------------------------HIARI 189 Lactobacillus ...
Q1GC31        142 LAAKYLNQIGQAYPN--------DrIYITGHSKGGNYAHYALAF-ADPQIQa-----------------------RVIKS 189 Lactobacillus ...
bgi:05SSU1597 153 AASGYLEKLMMQQGG--------H-FYLAGHSKGGNLALYAACQ-QATDQQd-----------------------RILAI 199 Streptococcus ...
Q8E024        151 SAIKYLNTILPYFDK----------VVLSGHSKGGNLALYAAMF-TKPDLKa-----------------------KIDLI 196 Streptococcus ...
Q8CYH6        143 HALRYLKNFFAHHPK--------QkVILAGHSKGGNLAIYAASQ-IEQSLQn-----------------------QITAV 190 Streptococcus ...
Q8G662        157 AAARYLTELAGHWAG--------P-IMVGGHSKGGNLAVYAAAN-VPSEIQe-----------------------RITVV 203 Bifidobacteriu...
Q8G7D3        233 SASAYLDMVARLWEG--------P-IILVGHSKGGNLAIYAAMN-ADPKVRk-----------------------RIQHV 279 Bifidobacteriu...
BAF38975      187 TAADYLARVAELWKD--------VpIVLTGHSKGGNLAVYAAMN-AEDGVKd-----------------------RIERI 234 Bifidobacteriu...
Q74J26        145 YALKYLTNILKTTKQ--------V-YSLAGHSKGGNLAEYAAVN-LPDDLKn-----------------------QIKTI 191 Lactobacillus ...
WP_003807625  310 DELTAGAQLIKRTLDGWLDTVSQEQRERAIDQIYG 344 Bifidobacterium adolescentis
Q74KR9        267 KQLDSTSEVSWKAIAEWLKNTNDTERKDFIEMLYL 301 Lactobacillus johnsonii
Q1GC31        264 EGLTTTARVIRHSLIAFNHQIPAEKRGQMWSALFE 298 Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 = JC...
bgi:05SSU1597 273 PALTSDSLQTDQALKTWTDSLTDDELRDFFDLFFg 307 Streptococcus suis 05ZYH33
Q8E024        271 TGLSLKSICFEKTFQQWMAELKSQERKLFFDLLFD 305 Streptococcus agalactiae serogroup V
Q8CYH6        265 DKTNSDSRQVDTTFKEWVATVPDEELQLYFDLFFg 299 Streptococcus pneumoniae R6
Q8G662        281 DGLTSSAQYLARTINGWMAKYDDEHRRKFIENLFA 315 Bifidobacterium longum
Q8G7D3        353 PDLSSSSQLFNEELNHWIATLTPEQRERAVDALFT 387 Bifidobacterium longum
BAF38975      308 EDVASSSVTFNKALNKWLANLSKEQRERAVDALFa 342 Bifidobacterium adolescentis ATCC 15703
Q74J26        260 AHRNPTSKIYNQIINQWIGEANLQEREALTNDLFN 294 Lactobacillus johnsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap