Conserved Protein Domain Family
Esterase_phd

?
pfam10503: Esterase_phd 
Esterase PHB depolymerase
This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
Statistics
?
PSSM-Id: 402228
View PSSM: pfam10503
Aligned: 4 rows
Threshold Bit Score: 291.383
Threshold Setting Gi: 120591128
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006220434       80 LTYARYTPAGAT--PAGMPLVVMLHGCRQTSLSFARGTRMNQWADAGGFMVLYPQQSMTRQVQRCWRWFQPDDAH-GGAE 156 Achromobac...
jgi:Bcen1808_4238  90 LAYALYVPQGRR--RGPMPLVVMLHGCQQSADEFAQGTRMNLLADQHGFAVLYPEQSMRAHAHGCWHWYEDTDRA-GRGE 166 Burkholder...
WP_035931356      102 LSYALYLPPGAA--LERMPLVVMLHGCKQNADQFAQGTRINLLADRYGFAVLYPEQSKHEHAHRCWRWYDESGAA-GGGE 178 Burkholder...
jgi:Aave_4027     107 LAYRLYLPPEVPgdGAPRPMVVMLHGCTQHAEDFAAGTRMNALARELGVVVLYPEQTQRANAQKCWNWFKPQHQQrGRGE 186 Acidovorax...
WP_006220434      157 ADLIAALIRSEVARHGLDPERVYVAGLSAGAGMAALVALRHPSLIAAVAMHSGPVVGDAHSAAAGIGTMRRGSLKPLLPL 236 Achromobac...
jgi:Bcen1808_4238 167 ADAVASLVDAVVDEHGFDASRVYVAGLSAGAGLATLLALHHPERFAAVALHSGPAVGEANSGISAMDVMRRGLRQNPAAA 246 Burkholder...
WP_035931356      179 AASVVSLVKAVVAQHRLDGERVYLAGMSAGAGLAALLAVRYPSVFAAVGLHSGVVFGEAHSAISAMDVMRRGSRSDPVAL 258 Burkholder...
jgi:Aave_4027     187 PAVIAALARSIATAHRVDPARVYVAGLSAGGAMADVVGHCYPDVFAAVGVHSGLPYGCAADVASALSAMRSGPGPAPGAT 266 Acidovorax...
WP_006220434      237 IEGVADPAVFDlGMPALILQGQLDPAVAPRNAKQLFEQFRALNPTRPEDVPVERVLGLGTEKA 299 Achromobacter piechaudii
jgi:Bcen1808_4238 247 VDALVDAGAYP-GMPALILQGDGDHVVAPKNADQLAVQFMRLNGLADSRGALRGGERVETRSA 308 Burkholderia vietnamiensis G4
WP_035931356      259 IDAAVDVRSYP-GMPAVIVHGELDSVVASANADQLTSQFLRLNGFIDATGARRAGETREEVQP 320 Burkholderiaceae
jgi:Aave_4027     267 TGARST------ALPTIVFHGDADTTVHVRNAESLVAALRSGSGRGAASGAAAAPRVTRGQSG 323 Acidovorax citrulli AAC00-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap