Conserved Protein Domain Family
PHB_depo_C

?
pfam06850: PHB_depo_C 
PHB de-polymerase C-terminus
This family represents the C-terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase. This degrades PHB granules to oligomers and monomers of 3-hydroxy-butyric acid.
Statistics
?
PSSM-Id: 399677
Aligned: 9 rows
Threshold Bit Score: 369.403
Threshold Setting Gi: 119373475
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZCP2              211 GGPIDARKNPTVVNEFALSKSLEWFCEMLTMQVPPNYPGYGRKVYPGFLQLTGFISLNLLRHIDSHLELWQSLLNSDYQK 290 Ricketts...
Q8PAX3              242 GGPIDARRSPTQVNNLATENGIEWFQNNLIHTVPFPYPGHGRQVYPGFLQHAGFLSMNPNRHVMSHWDFYTDLVKGDLQD 321 Xanthomo...
Q0KCI0              211 GGPIDARKSPTAVNSLATNKSFEWFENNVIYTVPANYPGHGRRVYPGFLQHAGFVAMNPDRHLSSHYDFYLSLVEGDADD 290 Cupriavi...
Q9ABH7              218 GSPIDARLSPTVTNQLAEEKPFTWFQSNMIYNVPPPYAGAGRRVYPGFVQLASFMSMNADRHQEAHRRYFNHLVSGDGDS 297 Caulobac...
Q92TD3              206 GGPIDTRINPTAVNELAKERPIEWFRDNVVMPVPWPQPGFMRMVYPGFLQLSGFMSMNLDRHLIAHKEFFAHLVKNDGDA 285 Sinorhiz...
Q89VY7              229 GGPIDTRRNPTAVNNLAQERGIDWFRNHVITKVPFPHPGMMRDVYPGFLQLNGFISMNLDRHMDAHKQLFAHLVKGDGDL 308 Bradyrhi...
Q89FJ7              205 AGPIDTRIQPTRVNEFAKSRPIDWFEQNLINYVPVQCRGALRKVYPGFVQLTAFVSMNLERHIKQHMDLANHIAKGEKEK 284 Bradyrhi...
jgi:Pden_0957       213 GGPIDPDAAATEVTDFGNRITMGELDYLMIQQVGFKYRGAGRMVYPGLAQLSSFIAMNAETHAKAFLDKIFAEARGQGSE 292 Paracocc...
rhodo:RCAP_rcc00745 207 GGPIDPDAAATEVTDFGRRVTMGQLEHMVIQRVGFKYKGAGRLVYPGLMQLASFISMNMDKHTKAFSDKILMESKGEGSE 286 Rhodobac...
Q9ZCP2              291 ADYIIKFYDEYLSGMDMPAEFYLQTIDEVFQQFSLARGKFISEKRPIDLKHITKCALLGIEGELDDIAAVGQTKAALKLC 370 Ricketts...
Q8PAX3              322 AQAHRQFYDEYNAVLDMPSEYYLDTIRVVFQEFLLPQGKWKVDGQLVMPSAIRNTALLSIEGELDDIAGLGQTEAVHDLC 401 Xanthomo...
Q0KCI0              291 AEAHVRFYDEYNAVLDMAAEYYLDTIREVFQEFRLANGTWAIDGNPVRPQDIKSTALMTVEGELDDISGAGQTAAAHDLC 370 Cupriavi...
Q9ABH7              298 ADKHLEFYDEYLSVLDLTEEFYLQTIDIVFQQYLLPKGELVHRGTRVKPEVITDIGLMTVEGENDDISGIGQTQAAHGLC 377 Caulobac...
Q92TD3              286 AEKHRDFYDEYLAVMDLTAEFYLQTVQVVFMQHALPKGEMIHRGKRVDPTAIRRVALLTVEGENDDISGLGQTKAAQTIC 365 Sinorhiz...
Q89VY7              309 VDKHREFYDEYLAVMDLSAEYYLQTVDTVFVKHALPKGEMTHRGTRVDLSKVKRVALMTVEGENDDISGLGQTEATHTLC 388 Bradyrhi...
Q89FJ7              285 AATIKTFYDEYFAVMDLPAEFYIETVRDVFQEHLLPQGKLMHRGRPVNTKAVSRMGLMTVEGEKDDICSIGQTLAAQDLC 364 Bradyrhi...
jgi:Pden_0957       293 GDKHNTFYDEYLAVMDMTAEFYLSTVERIFKEREIARNCFTVNGKPVDLGKITDVAVMTVEGANDDISAPGQCVAALALC 372 Paracocc...
rhodo:RCAP_rcc00745 287 HDHHNIFYDEYLAVMDMTAEFYLSTVERIFKGLEIAQNRFEVEGKRVDIGKITRVAVKTVEGANDDISAPGQCVAALRLC 366 Rhodobac...
Q9ZCP2              371 VNISESMKRYHLQNGVGHYGVFSGSKFKQFIVPLIKEFIYDFD 413 Rickettsia prowazekii
Q8PAX3              402 TGIDAAHRRHLVVEGAGHYGIFSGRRWREVVYPQVREFIARYD 444 Xanthomonas campestris pv. campestris
Q0KCI0              371 AGIPKIRKQHLNAAHCGHYGIFSGRRWREEIYPQLRDFIRKYh 413 Cupriavidus necator H16
Q9ABH7              378 ANIPEDMKLDYVQPSVGHYGVFNGRRFREEIYPRVRKFIRKCD 420 Caulobacter vibrioides
Q92TD3              366 TGIPDSMRQHYMQPDVGHYGVFNGSRFRREIAPRIVAFQRRHS 408 Sinorhizobium meliloti
Q89VY7              389 RSIPDHRRVHYVQKGVGHYGVFNGSRFKSEIVPRIHDFMVSAA 431 Bradyrhizobium japonicum
Q89FJ7              365 TGVRAYRRVHHMQAGVGHYGVFSGKRWNNEIYPLLRDFVHVNS 407 Bradyrhizobium japonicum
jgi:Pden_0957       373 TGVPESRKTQHLEPGAGHYGIFAGKSWRLNIRPLVLDFIDEql 415 Paracoccus denitrificans PD1222
rhodo:RCAP_rcc00745 367 TGLPEDKKAQHLEPGAGHYGIFAGSSWRNNIRPLVLNFIDANa 409 Rhodobacter capsulatus SB 1003
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap