5LYY


Conserved Protein Domain Family
PAF-AH_p_II

?
pfam03403: PAF-AH_p_II 
Click on image for an interactive view with Cn3D
Platelet-activating factor acetylhydrolase, isoform II
Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted.
Statistics
?
PSSM-Id: 397462
Aligned: 7 rows
Threshold Bit Score: 504.285
Threshold Setting Gi: 74638851
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LYY_A   3 AASFGQTKIPRGNGPYSVG-------------CTDLMFDHT-N--KGTFLRLYYPS---Q-DNDRLDTLWIPNKEYFWGL 62  human
P70683  48 ITSFGHTTIPKGNGPYSVG-------------CTDLMSGYT-N--QSSFLRLYYPS---Q-DNDFPDALWIPNEEYFQGL 107 domestic guinea pig
Q90678  31 GGAEKGYRIPAGKGPHAVG-------------CTDLMTGDA-A--EGSFLRLYYLSc--D-DTDTEETPWIPDKEYYQGL 91  chicken
Q60963  47 AAGSGHSKIPKGNGSYPVG-------------CTDLMFGYG-N--ESVFVRLYYPA---Q-DQGRLDTVWIPNKEYFLGL 106 house mouse
Q99487   1 MGVNQSVGFPPVTGPHLVG-------------CGDVMEGQN-L--QGSFFRLFYPCq--KaEETMEQPLWIPRYEYCTGL 62  human
Q9URV1   3 LGFSSKKQLPAYCGPLPVGslvlelsvpeefrCEYKTIEHK-L--RTVKVRIFYPLdptKdVEPRTDELWLPFHE---GI 76  Schizosaccharomyces p...
Q22943   4 YISSPQVLTRQVSGQFQVG-------------CKDLMIDGTvLgdRGLFMRLYFPTd-sQaADISSYPLWLPKPQYAHGL 69  Caenorhabditis elegans
5LYY_A  63 SKFLGTHWLMGNIL-RLLFGSMTTPANWNSPLRPG--EK-YPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRS 138 human
P70683 108 TETLGASSFLGKLL-KLLYGSVKVPAKWNSPLKTG--EK-YPLIIFSHGLGAFRSIYSAIGIELASHGFIVAAVEHRDES 183 domestic guinea pig
Q90678  92 SDFLNVYRALGERLfQYYVGSVTCPAKSNAAFKPG--EK-YPLLVFSHGLGAFRTIYSAICIEMASQGFLVAAVEHRDES 168 chicken
Q60963 107 SIFLGTPSIVGNIL-HLLYGSLTTPASWNSPLRTG--EK-YPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRS 182 house mouse
Q99487  63 AEYLQFNKRCGGLLfNLAVGSCRLPVSWNGPFKTK--DSgYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRS 140 human
Q9URV1  77 PEVAKGFRWWLLRAfASGLTNLALPVYKGELFHPPnnGK-LPVFIFSHGLVGSRNVYSSLCGTIASYGIVVLAMEHRDNS 155 Schizosaccharomyces p...
Q22943  70 GEYLGQSSQKMNVItSTVVGEKREDCIENAQMSTKc-DK-WPIVVFSHGLGGSRTFYSTYCTSLASHGYVVAAVEHKDHS 147 Caenorhabditis elegans
5LYY_A 139 ASATYYFKDQSAAEIG-------DKSWLYLRTLk-qEEETHIRNEQVRQRAKECSQALSLILDID-HGKPVKNA-----L 204 human
P70683 184 AAATYYFQDAPAAESG-------NRSWIYYKVG---NLETEERKRQLRQRGEECSQALSWLLSID-EGEPVKNV-----L 247 domestic guinea pig
Q90678 169 ASATYFCKKKADSEPEedqtsgvEKEWIYYRKLragEEERCLRHKQVQQRAQECIKALNLILKIS-SGEEVMNV-----L 242 chicken
Q60963 183 ASATYFFEDQVAAKVE-------NRSWLYLRKVk-qEESESVRKEQVQQRAIECSRALSAILDIE-HGDPKENV-----L 248 house mouse
Q99487 141 AATTYFCKQAP--EENqptneslQEEWIPFRRVeegEKEFHVRNPQVHQRVSECLRVLKILQEVT-AGQTVFNI-----L 212 human
Q9URV1 156 AIISTV-RDPLHPEEPpyvvqyrE-----ISDFy-aDATVVLQNERLLFRQQEIQIALQMIRNINdLGTPDENLpflcsV 228 Schizosaccharomyces p...
Q22943 148 ACWTYQLTEKNGELVE-------QPIKIKLIEKn-eKNEFKIRNQQVGKRVTECVKALNVLEQLN-LGTVPEKVl----I 214 Caenorhabditis elegans
5LYY_A 205 DLKFD---MEQLKDSIDREK--IAVIGHSFGGATVI-------QTLSED----QRFRCGIALDAWMFPLGDEVY-SRIPQ 267 human
P70683 248 DLNFD---IQQLKGSLDRSK--VAIIGHSFGGATVI-------QTLSED----QRFRCGIALDPWMFPVGEDVH-SKIPQ 310 domestic guinea pig
Q90678 243 NSDFD---WNHLKDSVDTSR--IAVMGHSFGGATVI-------ESLSKE----IRFRCGIALDAWMLPVGDDTYqSSVQQ 306 chicken
Q60963 249 GSAFD---MKQLKDAIDETK--IALMGHSFGGATVL-------QALSED----QRFRCGVALDPWMYPVNEELY-SRTLQ 311 house mouse
Q99487 213 PGGLD---LMTLKGNIDMSR--VAVMGHSFGGATAI-------LALAKE----TQFRCAVALDAWMFPLERDFY-PKARG 275 human
Q9URV1 229 DSSFYnsvFQSMKGNLNTAQgeLIVAGHSFGAATCAfisgsstKSLYNDymfhTEFKCSILYDIWMLPVRQLHL-STMRY 307 Schizosaccharomyces p...
Q22943 215 GNDYN---WAQFKNKLVMSS--ASVIGHSFGGATSL-------ASSAYT----TDFQKAIVFDGWMYPLDSTQQ-EQAKQ 277 Caenorhabditis elegans
5LYY_A 268 PLFFINSEYFQYPANIIKMKK----------------------CYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLK 325 human
P70683 311 PLFFINSEYFQSANDTKKIEK----------------------FYQPQKERKMIAVKGSVHHNFVDFTFATGKIIGQMLS 368 domestic guinea pig
Q90678 307 PLLFINSEKFQWAANILKMKK----------------------LSSNDTNKKMITIKGSVHQSFPDFTFVSGEIIGKFFK 364 chicken
Q60963 312 PLLFINSAKFQTPKDIAKMKK----------------------FYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLT 369 house mouse
Q99487 276 PVFFINTEKFQTMESVNLMKK----------------------ICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFS 333 human
Q9URV1 308 PTLMIISYEFRRFVDNFQALEswlvnkdsenqnagesadekmsVVPLKKYSHVFVYDGTVHANQSDLPILLPRMVLRVLK 387 Schizosaccharomyces p...
Q22943 278 PTLFLNVGDWQWNENLDVMKK----------------------IISHNDGNLALTLNGAVHQCFSDFPFIFPSWLAKKFG 335 Caenorhabditis elegans
5LYY_A 326 L--KGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENL 371 human
P70683 369 L--KGKIDSEVAMDLINKASLAFLQKYLGLDKNFDQWNSLMEGDDENL 414 domestic guinea pig
Q90678 365 L--KGEIDPNEAIDICNHASLAFLQKHLSLKRDFDKWDSLVDGIGPNV 410 chicken
Q60963 370 L--KGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENL 415 house mouse
Q99487 334 TetRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSL 381 human
Q9URV1 388 G--KFEADPYEALRINTRSSVQFLREN---HVENVQGDNDPSSLQTNI 430 Schizosaccharomyces pombe 972h-
Q22943 336 V--QGRTEPSLCMQAAIELSLAFLENGKD---------GAQKLKDEKF 372 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap