2XMR


Conserved Protein Domain Family
Ndr

?
pfam03096: Ndr 
Click on image for an interactive view with Cn3D
Ndr family
This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3. Their similarity was previously noted. The precise molecular and cellular function of members of this family is still unknown. Yet, they are known to be involved in cellular differentiation events. The Ndr1 group was the first to be discovered. Their expression is repressed by the proto-oncogenes N-myc and c-myc, and in line with this observation, Ndr1 protein expression is down-regulated in neoplastic cells, and is reactivated when differentiation is induced by chemicals such as retinoic acid. Ndr2 and Ndr3 expression is not under the control of N-myc or c-myc. Ndr1 expression is also activated by several chemicals: tunicamycin and homocysteine induce Ndr1 in human umbilical endothelial cells; nickel induces Ndr1 in several cell types. Members of this family are found in wide variety of multicellular eukaryotes, including an Ndr1 type protein in Helianthus annuus (sunflower), known as Sf21. Interestingly, the highest scoring matches in the noise are all alpha/beta hydrolases pfam00561, suggesting that this family may have an enzymatic function (Bateman A pers. obs.).
Statistics
?
PSSM-Id: 397285
View PSSM: pfam03096
Aligned: 10 rows
Threshold Bit Score: 385.938
Threshold Setting Gi: 194198206
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2XMR_B     3 THSVETPYGSVTFTVYGTPAP--ARPAILTYHDVGLNYKSCFQPLFQF-EDMQEIIQNFVRVHVDAPGMEEGAPVFPLGY 79  human
Q9Z2L9     8 EHDIETPYGLLHVVIRGSPKG--NRPAILTYHDVGLNHKLCFNTLFNL-EDMQEITKHFVVCHVDAPGQQVGASQFPQGY 84  Norway rat
Q9QYF9    32 EHDIETPHGMVHVTIRGLPKG--NRPVILTYHDIGLNHKSCFNTFFNF-EDMQEITQHFAVCHVDAPGQQEAAPSFPTGY 108 house mouse
Q62433    34 EQDIETLHGSLHVTLCGTPKG--NRPVILTYHDIGMNHKTCYNPLFNS-EDMQEITQHFAVCHVDAPGQQDGAPSFPVGY 110 house mouse
Q9U283    26 EEKVNTAFGAIKVSIYGDRNDp-KKVPMVTFHDLGLDSESNFQNFFQF-VSIAEFADKFCIYNVNAPGQEMDAQPLPENF 103 Caenorhabditis elegans
Q9ZUN1    21 EHHVKTCHGSVSVVVYGDQE----KPALITYPDVALNYMSCFQGLFLCpEAVSLLLHNFCIYHISPPGHEFGAAPVCSND 96  thale cress
Q9SP24    21 EHIIQTGCGSVSVTVYGDQQ----KPPLITYPDLGLNHTSCFEGLFISpESASLLLNNFCIYHITPPGHESGAATISKDE 96  common sunflower
O23969    21 EHIIRTGCGSVSVTVCGDQE----KPPLITYPDLALNHMSCFQGLFVSpESASLLLHNFCIYHINPPGHELGAASIGIDD 96  common sunflower
O02485     9 VVVQAQNCGVLHVYVQGNLEErgGKTIILTVHDIGTNHKS-FVRFVNH-PSMATVKEKAIFLHVCVPGQEDNSADFFGD- 85  Caenorhabditis elegans
EDX11782  26 YNISTEKCGDLTVIVQGDLSQqeKRAVFITVHDLGCNHNS-FQEFVSS-PCMTEIKERSCFIHVDVPGHADNAEALADGF 103 Drosophila simulans
2XMR_B    80 QYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLT-------GL 152 human
Q9Z2L9    85 QFPSMEQLATMLPNVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNGKGWIDWAATKLS-------GL 157 Norway rat
Q9QYF9   109 QYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLS-------GF 181 house mouse
Q62433   111 MYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKIS-------GW 183 house mouse
Q9U283   104 TYPTMDGIAKTIESVADHFKLNQFIGFGVGVGANVLLRYAAQNQNRVIALVLVNCCSGKSGWVEWGYEKWNtsylrkvGM 183 Caenorhabditis elegans
Q9ZUN1    97 PSPSVEDLADQILEVLNFFSLEAVMCMGITAGAYILSLFAIKHKERVLGLILISPLCKAPSWSEWFYYKVVsnllyyyGM 176 thale cress
Q9SP24    97 PVLSVVDLCDQILVILNHFRLGSVMCMGAMAGAYILTLFSIKYSERVSGLILVSPICRAASWNEWFYNKFMskllqycGM 176 common sunflower
O23969    97 PVPSIEDLCDQILVVLNYFRLGSVMCMGAMAGAYILTLFSIKYSERVTGLILISPICKAPSWTERFYNKLTsktlyyyGM 176 common sunflower
O02485    86 -FPTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMnmrlensIM 164 Caenorhabditis elegans
EDX11782 104 PFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFIswk--sdEV 181 Drosophila simulans
2XMR_B   153 TSSIPEMILGHLFSQEELSG----NSE---LIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDI-------TlRC 218 human
Q9Z2L9   158 TSTLPDTVLSHLFSQEELVN----NTE---LVQSYRQQISSVVNQANLQLFWNMYNSRRDLDINRPGTVpn---akTlRC 227 Norway rat
Q9QYF9   182 TTNIVDIILAHHFGQEELQA----NLD---LIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGqndnrlkTlKC 254 house mouse
Q62433   184 TQALPDMVVSHLFGKEEIHN----NVE---VVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGth---tvTlQC 253 house mouse
Q9U283   184 TKFTVDYLMWHHFGRNYDRC----SPD---IVRQYRVFFQHLPNPNSLAEFIESYIQRTPLPISRDGTTg-----vQlKV 251 Caenorhabditis elegans
Q9ZUN1   177 SGLLKDIFLQRYFSKEARGSsevpERD---VVHECRRLLGERHG-SSLMRFLEAVNRRHDLTDGLKSLK----------C 242 thale cress
Q9SP24   177 CDMFKELLNPRYFSKAGCev---pESE---IVRACRKFLNERDS-INVRRYLQALDRRHDMSKELETLE----------C 239 common sunflower
O23969   177 CDLVKELLIHRYFSKEVCGNpeipESD---MVLACRKLLDERDS-VNVWRYLQAIDSRRDITEELKSLE----------C 242 common sunflower
O02485   165 SDGAWDYLLAHKFGGESKSR----------QE--YLEELKATLNPKNLSKYLVAFTKRTDLSSTIGTKLe--------tV 224 Caenorhabditis elegans
EDX11782 182 AQSAESFLMYHKFGHVMEQIvg-eNPDkekIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVD----------V 250 Drosophila simulans
2XMR_B   219 PVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA 281 human
Q9Z2L9   228 PVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIA 290 Norway rat
Q9QYF9   255 STLLVVGDNSPAVEAVVECNSRLDPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIP 317 house mouse
Q62433   254 PALLVVGDNSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMP 316 house mouse
Q9U283   252 PVLQLVGAGSAHVEDTVEVNTKLDPAHADWIKISDSCGLVLDDRPDAVTESMMLFLQGLGYFP 314 Caenorhabditis elegans
Q9ZUN1   243 RTLIFVGDQSPFHSETLHMVTALDRKYSALVEVQACGSMVTEEQPHAMLIPMEFFFMGFGLYR 305 thale cress
Q9SP24   240 KSIIFVGDKSPFLDDALHMKTILGKRCSAFVEVHPCGSMVTEEQPHAMLIPLELFLKGFGFYR 302 common sunflower
O23969   243 KTIIFVGDSSPFHDEALQIAEKLGTNCSALVEVHACGSMVTQEQPHAMLIPLENFLKGFGLYR 305 common sunflower
O02485   225 DALLVTGSKASHLHTVYTTHKSMNKKKTTLLVVDNV-ADVMQEAPDKLARSLILLCKGCGVLS 286 Caenorhabditis elegans
EDX11782 251 --ILITGMLSPYASMVEKLHRDVEKERVTILKIERA-GDVLADAPGKVAQSILLFCKGQGLLT 310 Drosophila simulans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap