5GAS


Conserved Protein Domain Family
vATP-synt_AC39

?
pfam01992: vATP-synt_AC39 
Click on image for an interactive view with Cn3D
ATP synthase (C/AC39) subunit
This family includes the AC39 subunit from vacuolar ATP synthase, and the C subunit from archaebacterial ATP synthase. The family also includes subunit C from the Sodium transporting ATP synthase from Enterococcus hirae.
Statistics
?
PSSM-Id: 396538
View PSSM: pfam01992
Aligned: 319 rows
Threshold Bit Score: 83.8609
Threshold Setting Gi: 121697357
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5GAS_M                8 LNARVRVRRGTLLKESFFQEALDL-SFADFLRLL-SEtVYGGElA----GQGlpDVDRAVLRTQAKLVGDLPRLVTGe-A 80  Thermus ...
EHY65935              7 iinyVHGNKNMLLKEEHYRIIKAAnDLDDLKVKL-QStIYGKYlLes--ktSlaSFKSAMYKCIDQQIKITRSFTTDksS 83  Nematoci...
WGS:AFBI:EDEG_02744  14 IIGSIHGKALTMLKDTDYSSLQQCdTLEDVIVKL-TStPYQKYlTee-aiVTkkQFKTQLIKCLTSEFDELCQTSNKdlE 91  Edhazard...
Q8SR97               26 IISEINGKKEEMLKEEDYNALKRCeNLEEVAIKL-SK--TYRSlSeg-iaYTkpELKKRLLETLKADFDHYRDVEDKgiR 101 Encephal...
XP_002032312         12 LEALTRGFKNGMLKHSDYLNLTQCeSLEDVMISI-QGtDYGLIfGgeqsAPSveRIERCLRDRLMQQYYYIRSHSTEplT 90  Drosophi...
XP_002014084         12 LEGITRGFKNGMLKHSDYLALTQCeSLEDVMMNI-QStDYGNIfSnd-rKFSveLIEKRLGEKLLNEFNYIRAHSTDplS 89  Drosophi...
jgi:OSTLU_119494      9 sEAHVRGCQTKRLTKQNYAELSRCdTLEDIKTYLqTMsDYSEYvRdlqaPVRpvDIIECCRKRQIAEFNICCQQASSplS 88  Ostreoco...
A0CYK5               13 AEAIIRGLRASFLTEAQYQQMKNCaSIPELKSFL-EEtDYQNClQadnpQIPtsILRQRLKKKLADEFEYIEAQSTGtlT 91  Parameci...
XP_001323750         13 lDGYVRACFTEFLTEADYMQLKQCeTLEDFRLHL-SNaGFQSYlQndagTASptVIYERCLERLVDKFNYVESQASDelK 91  Trichomo...
XP_001011374         13 AEAILRGLRASFITQAQYTQMKTSnNLQDLKSHL-EEtDYANYlQndvvELTipLLRQKLKKKLADELEYIQAQSVGklN 91  Tetrahym...
5GAS_M               81 rEAVRLLLLRNDLHNLQALLRAKAT--GRpfEev--lLL-P--G-TLrEEVW-RqayeAQDPAGMAQVLAvpGHPLARAL 151 Thermus ...
EHY65935             84 -ALIDFYKEKFQLDNFIYLWACKKEspKL--LeteidTHpLggYpGLdFIKV------TQSAKDTWKYCLe-NTSLSKYV 153 Nematoci...
WGS:AFBI:EDEG_02744  92 -IVLNFFRDQFRIQNFVFLLASKEEepNL--DksfekIEkIgdFsELcALKV------ANDMNDVFKFCVe-NTFLEKFY 161 Edhazard...
Q8SR97              102 -TILDYYMDFHKIQNFFYLLQCKLQdpNL--GrsfekIE-IgdFsALrTIKF------SNNMDDVQRYCMe-NSFLKKFE 170 Encephal...
XP_002032312         91 -TFMEFIRYPFMIDNVALLVAGLNNhrSM--KrllrmCHpLgeFdQLgAIEV------ASNSAELFDAVLi-DTPIARFV 160 Drosophi...
XP_002014084         90 -SFLEYIRYPYMIDNVALLIAGLNNnrPM--KrllemCHpLgyFdQLaAIEV------AISSVELFNAVLi-DTPLAKFI 159 Drosophi...
jgi:OSTLU_119494     89 -NFLEYLTYGYMIDNLVLALNGMLRgrTT--EailekCSpIgfFdSLsAVVV------SSSVQELYRLALv-DTPLASYF 158 Ostreoco...
A0CYK5               92 -KYLFHLRCRFMIDNVVNMIEGLKNkiDI--EillsnIDpLgwFpEIkNIKVlE----GDDYSSLYRDVLi-DTPIGVYF 163 Parameci...
XP_001323750         92 -TFFQWLRIPFMIDNVIIIISGVVHdhDV--TelierCHpLgmFdGIkALAV------ASTVQDLYQMVLv-DTPLGPLF 161 Trichomo...
XP_001011374         92 -EFINMMKHRYMIDNVVNMIEGIKNkvHK--DdliaaADpLgfFpEMtQISVfD----KDDYSELYQEVLi-DTPVGPYF 163 Tetrahym...
5GAS_M              152 RA-V-------------------LRetqdlARVEALLAKRFFEDVAKAAK-GLDQPA---LRDYLALEVDAENLRTAFKL 207 Thermus ...
EHY65935            154 egl-----------------dsdLLnr-diQYVKSVLQKRYIEFVYDYCM-K----NdlcLSELIVFEGDKIIIEILYAL 210 Nematoci...
WGS:AFBI:EDEG_02744 162 RTiHfe---------------reIKdn-dmQVIQSLLLKGLFNDVYQKVL---DIPSlyyFRTILQMEGDRRIIEIVINS 222 Edhazard...
Q8SR97              171 ERvRfk---------------keFSan-nfQVLQTLFFKFHIEETYRNLN---D--DmehMREILRLEGDRQIIEIAMNT 229 Encephal...
XP_002032312        161 PRdLpm---------------esLRyl-dvEIVRAHLYRAYLEKFYAYCS-QLGGNTanvMTNLLSFEADRRTITIAVNA 223 Drosophi...
XP_002014084        160 PPnFhe---------------etFIei-dvEIVRGVLYRSYLESFYAFCE-GLGGTTsnvMCKLLGFEADRRVITITVNA 222 Drosophi...
jgi:OSTLU_119494    159 SSsIka---------------edLDel-niELIRNVLYKEYLQDFMVFCN-KMDQNTrqlMEKLLSMEADRHAIRITLNS 221 Ostreoco...
A0CYK5              164 MKfLeetln---------diqnlFRem-kpEYIRTSLKKMWLEDFYLFCEqELMPTSqeaLLELLKFEADFKTVQVIYNS 233 Parameci...
XP_001323750        162 SKcLnt---------------nsLSeq-nvESIRLKLYREYYDQFYEFCK-NLGSETalvMCDLLEFEADRRAIIITLNS 224 Trichomo...
XP_001011374        164 MRfLescmhgvsencgmnvvqeiFKem-rpEHIRTSLKKMWLEDFHEYCVeQLNSTSaeiLDDLLKFEADMKSIQVVYNT 242 Tetrahym...
5GAS_M              208 QGSGlap-------daF---FLKGGrFVDRVRFARLM-EGDY-----AV--LDELSGTPFSGLSGV---------RD--L 258 Thermus ...
EHY65935            211 MN-Gnms------tseKlslFPRCN-SFTNVHKELLL-NCKNtseleGVlsTHIKYRNIVGn-----------------E 264 Nematoci...
WGS:AFBI:EDEG_02744 223 LESSdiv------gkqReilFPEVS-SIDLGMRAKLA-TCTSmdelrGVvsSHSVLRRIVTv----------------eD 278 Edhazard...
Q8SR97              230 LNSKdlv------grkRmslFPDVH-SMDLRTRELLS-HVEGledmkSVlsTRYNF-----------------------D 278 Encephal...
XP_002032312        224 IG-Sdis------pkdRlkmFPTCG-YLPKIALASMS-NLNEtdkirDVcnVFDGYGKMFDNLERD----------SdgM 284 Drosophi...
XP_002014084        223 LP-Thlt------aedRlkmYPTCG-NLPDLALRTLS-EVSDydrvrDVc-NFAGYGDMFDNIERD----------TdgL 282 Drosophi...
jgi:OSTLU_119494    222 FG-Tels------kadRrnlYTNFG-TMYPDGFARLA-NCETvdevkRIlvAYPEFRELT-----K----------SddP 277 Ostreoco...
A0CYK5              234 IG-NrdlntaakiittRkqlCPTIG-NLYPDCEKLYL-QAMTldalrEAvkGCDNYRDLLK----DapdplkreeFNvqT 306 Parameci...
XP_001323750        225 IR-Tsmi------addRealYPRIG-QLATITSK-LAaKGAGettlaDAlqPFETYKKLFDL---S----------RtsS 282 Trichomo...
XP_001011374        243 Iqhtva-----ksqevRkqlTPALG-YLYPDCQTSLK-NARSldeikEAikGCENYGNIVK----DapdpsrkeeQNfaT 311 Tetrahym...
5GAS_M              259 KALERGLRCVLLKEAKKGVQDPLGVGLVLAYVKEREWEAVRLRLLARRAYFGlPRAQV 316 Thermus thermophilus
EHY65935            265 TGVEDALLREEIRLCNKSFYIYDDYSVVYTQLILQEIEVRNIIFLADCVIQG-HNhrd 321 Nematocida sp. 1 ERTm2
WGS:AFBI:EDEG_02744 279 DQIVNELAALEVEKYWHSFGYFNDISCVYSYLKLKEQEIKNILWTVECISLQ-KRDFI 335 Edhazardia aedis USNM 41457
Q8SR97              279 KDISNVLIRAELQKYQESFSMYGDLSCVYSYFKIKEQEIKNILWVAECIIQN-RRDAM 335 Encephalitozoon cuniculi
XP_002032312        285 ITLEDRFLMMEAKKNVQTFLQQYHFGIFYSFIKLKQLEVRNIVWISECIAQR-QTDRI 341 Drosophila sechellia
XP_002014084        283 IGLEDRFLMVEAKNNVQSYLQQFHYGIFYSYVKLKQLESRNIIWICECISQR-QTDNV 339 Drosophila persimilis
jgi:OSTLU_119494    278 HYIDRGLRVLELEACGQALDEQFNFAIFYAFVKFQENEINNLMWLTECVAQR-QKSsl 334 Ostreococcus lucimarinus CCE9901
A0CYK5              307 KTLDDIMYDDECRRYALAFDGQGSYGVFYSYLKLKEQEIRNIIWLAEMISRKlAknhp 364 Paramecium tetraurelia
XP_001323750        283 KTIEEVFLERAALMHVESFSVFFSFAVFYSWVQLMDQEVRNIQWIAECIHQG-KRDRA 339 Trichomonas vaginalis G3
XP_001011374        312 -SLEDLMYDEEIKRYSLAFDQAAQYAVFYAYLKLKEQEIRNIVWLAEMITRNlPKnsp 368 Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap