6NTF


Conserved Protein Domain Family
Hemagglutinin

?
pfam00509: Hemagglutinin 
Haemagglutinin
Haemagglutinin from influenza virus causes membrane fusion of the viral membrane with the host membrane. Fusion occurs after the host cell internalizes the virus by endocytosis. The drop of pH causes release of a hydrophobic fusion peptide and a large conformational change leading to membrane fusion.
Statistics
?
PSSM-Id: 395409
View PSSM: pfam00509
Aligned: 4 rows
Threshold Bit Score: 784.53
Threshold Setting Gi: 122961
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6NTF_A   3 ICIGYHANNSTEQVDTIMEKNVTVT------------HAQDILEKTHNGKLCdldgvkPLILrDCSVAGWLLGNPMCDEF 70 
P03460  18 ICTGITSSNSPHVVKTATQGEVNVTgvipltttptksHFANLKGTQTRGKLC------PNCF-NCTDLDVALGRPKCMGN 90  Influenza B virus (B/...
P03452  20 ICIGYHANNSTDTVDTVLEKNVTVT------------HSVNLLEDSHNGKLCrlkgiaPLQLgKCNIAGWLLGNPECDPL 87  Influenza A virus (A/...
Q9Q0U6  19 ICIGYHANNSTEQVDTIMEKNVTVT------------HAQDILEKTHNGKLCdlngvkPLILrDCSVAGWLLGNPMCDEF 86  Influenza A virus (A/...
6NTF_A  71 INVPEWSyIVEKANPANDLCFPgNFNDYEELKHLLSRINHFEKIQIipK-SSWSDHEASS------GVSSACPY-QGSPS 142
P03460  91 TPSAKVS-ILHEVKPATSGCFP-IMHDRTKIRQLPNLLRGYENIRL--StSNVINTETAPggpykvGTSGSCPNvANGNG 166 Influenza B virus (B/...
P03452  88 LPVRSWSyIVETPNSENGICYPgDFIDYEELREQLSSVSSFERFEIfpKeSSWPNHNTN-------GVTAACSH-EGKSS 159 Influenza A virus (A/...
Q9Q0U6  87 INVPEWSyIVEKASPANDLCYPgDFNDYEELKHLLSRTNHFEKIQIipK-SSWSNHDASS------GVSSACPY-HGRSS 158 Influenza A virus (A/...
6NTF_A 143 FFRNVVWLIKKNNTYP-----TIKRSYNNTNQEDLLVLWGIhHPNDAAEQTRLY--QNPTTYISvGTSTLNQRLVPKIAT 215
P03460 167 FFNTMAWVIPKDNNKTainpvTVEVPYICSEGEDQITVWGF-HSDDKTQMERLYgdSNPQKFTS-SANGVTTHYVSQIGG 244 Influenza B virus (B/...
P03452 160 FYRNLLWLTEKEGSYP-----KLKNSYVNKKGKEVLVLWGIhHPPNSKEQQNLY--QNENAYVSvVTSNYNRRFTPEIAE 232 Influenza A virus (A/...
Q9Q0U6 159 FFRNVVWLIKKNSAYP-----TIKRSYNNTNQEDLLVLWGIhHPNDAAEQTKLY--QNPTTYISvGTSTLNQRLVPEIAT 231 Influenza A virus (A/...
6NTF_A 216 RSKVNG-----QSGRMEFFWTILKPNDAINFESNGNFIAPEYAYkiVKKGDSAIMKSELEY---GNCntkCQTPIGAINS 287
P03460 245 FPNQTEdeglkQSGRIVVDYMVQKPGKTGTIVYQRGILLPQKVW--CASGRSKVIKGSLPLigeADC---LHEKYGGLNK 319 Influenza B virus (B/...
P03452 233 RPKVRD-----QAGRMNYYWTLLKPGDTIIFEANGNLIAPMYAFalSRGFGSGIITSNASM---HECntkCQTPLGAINS 304 Influenza A virus (A/...
Q9Q0U6 232 RPKVNG-----QSGRMEFFWTILKPNDAINFESNGNFIAPEYAYkiVKKGDSAIMKSELEY---GNCntkCQTPMGAINS 303 Influenza A virus (A/...
6NTF_A 288 SMPFHN-IHPLTIGECPKYVKSNrLVLATGLRNSPQREsRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAA 366
P03460 320 SKPYYTgEHAKAIGNCPIWVKTP-LKLANGTKYRPPAK-LLKERGFFGAIAGFLEGGWEGMIAGWHGYTSHGAHGVAVAA 397 Influenza B virus (B/...
P03452 305 SLPYQN-IHPVTIGECPKYVRSAkLRMVTGLRNIPSIQ----SRGLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAA 379 Influenza A virus (A/...
Q9Q0U6 304 SMPFHN-IHPLTIGECPKYVKSNrLVLATGLRNTPQRErRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAA 382 Influenza A virus (A/...
6NTF_A 367 DKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVK 446
P03460 398 DLKSTQEAINKITKNLNYLSELEVKNLQRLSGAMNELHDEILELDEKVDDLRADTISSQIELAVLLSNEGIINSEDEHLL 477 Influenza B virus (B/...
P03452 380 DQKSTQNAINGITNKVNTVIEKMNIQFTAVGKEFNKLEKRMENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVK 459 Influenza A virus (A/...
Q9Q0U6 383 DKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKQMEDGFLDVWTYNAELLVLMENERTLDFHDSNVK 462 Influenza A virus (A/...
6NTF_A 447 NLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS---------EEARLKREEISG 505
P03460 478 ALERKLKKMLGPSAVEIGNGCFETKHKCNQTCLDRIAAGTFNAGDFSlptfdslniTAASLNDDGLDN 545 Influenza B virus (B/Lee/1940)
P03452 460 NLYEKVKSQLKNNAKEIGNGCFEFYHKCDNECMESVRNGTYDYPKYS---------EESKLNREKVDG 518 Influenza A virus (A/Puerto Rico/...
Q9Q0U6 463 NLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVKNGTYDYPQYS---------EEARLNREEISG 521 Influenza A virus (A/goose/Guangd...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap