3L4R


Conserved Protein Domain Family
lipocalin_Can_f_2

?
cd19431: lipocalin_Can_f_2 
Minor allergen Can f 2
The minor dog lipocalin allergen Can f 2 is an important cause of allergic sensitization in humans worldwide. It is one of two major allergens present in dog dander extracts, and is produced by tongue and the parotid gland (a major salivary gland). Can f 2 belongs to the lipocalin/cytosolic fatty-acid binding protein family which have a large beta-barrel ligand-binding cavity. Lipocalins are mainly low molecular weight extracellular proteins that bind principally small hydrophobic ligands, and form covalent or non-covalent complexes with soluble macromolecules, as well as membrane bound-receptors. They participate in processes such as ligand transport, modulation of cell growth and metabolism, regulation of immune response, smell reception, tissue development and animal behavior. Cytosolic fatty-acid binding proteins, also bind hydrophobic ligands in a non-covalent, reversible manner, and have been implicated in intracellular uptake, transport and storage of hydrophobic ligands, regulation of lipid metabolism and sequestration of excess toxic fatty acids, as well as in signaling, gene expression, inflammation, cell growth and proliferation, and cancer development.
Statistics
?
PSSM-Id: 381206
Aligned: 3 rows
Threshold Bit Score: 324.728
Threshold Setting Gi: 296863542
Created: 7-Jan-2013
Updated: 31-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
 
ligand binding
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding cavity [chemical binding site]
Evidence:
  • Comment:hydrophobic cavity binds different hydrophobic ligands; ligands are bound within the beta-barrel in a central internal water-filled cavity lined with polar and hydrophobic amino acids
  • Comment:based on dog Can f 2 and on other lipocalin/cytosolic fatty-acid binding protein family members with structure
  • Structure:3L4R; dog Can f 2 bound with glycerol, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #   #                       # #      # # #          # # #        #
3L4R_A         1 MEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKF 80  dog
O18874        19 QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKF 98  dog
NP_001003189  19 QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKF 98  dog
Feature 1         #     # # #        # # #          # # #                                        
3L4R_A        81 DLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDlSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGS 160 dog
O18874        99 DLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDlSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGS 178 dog
NP_001003189  99 DLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDlSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGS 178 dog
Feature 1          
3L4R_A       161 RD 162 dog
O18874       179 RD 180 dog
NP_001003189 179 RD 180 dog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap