Conserved Protein Domain Family
M48B_HtpX_like

?
cd07336: M48B_HtpX_like 
Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase
This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.
Statistics
?
PSSM-Id: 320695
View PSSM: cd07336
Aligned: 72 rows
Threshold Bit Score: 346.403
Threshold Setting Gi: 189036285
Created: 25-Feb-2009
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Zn binding siteputative active
Feature 1:Zn binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
O58997     16 LTVVLVGIGYLLGGtgGMIIAFTLalFMNLISYWFSDSIVLNWYNARIVseeeAPELHYIVEKLARQAGIPKPRVAIVPT 95  Pyrococcus horikos...
KGM38640   14 MTALILWVGQLLGGrqGMIIALIFaaGMNFFSYWYSDKLVLKMYRASEAtpnqAPELYGMVQQLTHQAGLPMPKLFIIPQ 93  Spirochaeta sp. JC202
CCU78116   13 LIIVFMFFGGMIAGqdGIVMAFIFalAINFISYWNSDKIAIKMTKSKPLneseAPEIYNIVRKLTQNNKMPMPEIYLTPS 92  Halanaerobium sacc...
KFA92027   38 LTALLLFVGERLGGpqGLVVAGFFvvVMNFGSYWFSDRIALAMHGARPLeyaeAPWLHQMVERLAARAGMPKPKLYLLPT 117 Cystobacter violac...
AGQ19686   13 MTLIVVFTAQALGF--SLISSLFFafLLNFIMYFNSAKIALASTKAKKIedgtYQEVKDIVEFLSQKEKMPAPQLYIIES 90  Candidatus Actinom...
ADV82309   13 MTLLLLGIGRAFGGsnGMTIALLIagIMNFVSYFYSDKIALRMSNAQPAtreqLPRVYAIVERLTQKQGLPMPKLYTLPD 92  Terriglobus saanen...
KKR18819   13 LSALMVLLGKTFGGqtGMLIMLGIslAMNFFGYWFSDKMVLKMTKAKPVskdkERELYHMVEEISHSAGIPVPKIYMTDD 92  candidate division...
ANM31806   16 LTGILVMMGQWAGGsvGMIFALGLavVMNFSAYWFSDKIVLRMYKASPVtaseAPRLHAITRNLVARAGLPMPALYVLPQ 95  Acidobacteria bact...
ABS26972   33 LIAILAIGGQMVGGtgGMLLFGAIglVFNLLSYWFSDRIALMAHRAQPVtreqLPDVYEIVERLTRKAGIPMPRVFVIPS 112 Anaeromyxobacter s...
EKD65672   14 LSVLLITVGGLLGGqeGIYMAFFFslLMNGAAYFFSDKLALKMSGAKPIkkrdYPQLFEIVEDLSRKMKIPMPKMYITPA 93  uncultured bacterium
Feature 1                                          #   #                                      
O58997     96 MVPNAFATGRSPRNAVVAVTEGLLQLLNKDELEGVIAHEISHIKNRDTLIQTIAAVLAGAIMILVDFARWslwfgaydde 175 Pyrococcus horikos...
KGM38640   94 DAPNAFATGRNPEHAVVAVTQGLLKIMDRDEVIGVLAHELAHVKNRDILIGSVAATMAGAIMILATMARWsaifgggshd 173 Spirochaeta sp. JC202
CCU78116   93 NQPNAFATGRNPDHAAIAVTRGLIRLLNKDELEGVIAHELAHVKNRDTLISTMAAVMAGALAFLARIGRFrmifggrrn- 171 Halanaerobium sacc...
KFA92027  118 RTPNAFATGRNPEHAAVAVTAGIVDILDQRELEGVLAHELAHVKNRDTLIGTVAATLAGVISYAAQMLFWfggsllsrdd 197 Cystobacter violac...
AGQ19686   91 DQPNAFATGRNPKNSAVAVTTGILKVLNRDELEGVLAHELSHIKNNDILVSSIAAMLAAAISFMSRMYFWgggrrdr--- 167 Candidatus Actinom...
ADV82309   93 NSANAFATGRNPEHASVAVTQGILQLLDDEELEGVLAHELSHVRNRDILTASIAATLAGAITWIAHIGRWgmifggyggr 172 Terriglobus saanen...
KKR18819   93 MQPNAFATGRNHNHAVVAVTRGLMELVDKNELKGVIAHEIAHVKNRDILIGSVAAMMAGVISYLAQIAQWgamfggfggd 172 candidate division...
ANM31806   96 DAPNAFATGRNPAHSAVAVTRGLMQSMNDDELAGVVAHELAHIKNRDILTASIAATIAGAVSMLASMFQWmaifgggghr 175 Acidobacteria bact...
ABS26972  113 ATPNAFATGRNPSHSAVAVTQGILGILDKRQLEGVLAHELAHVRNRDVLIATIAAAVAGLIASLGHMIQWgaifggfggr 192 Anaeromyxobacter s...
EKD65672   94 AQANAFATGRDPSHASVAVTKGIMNILSKEELKGVLAHELSHVKNRDILVASVAAVIASAISFLANMSLFgafsrgdn-- 171 uncultured bacterium
Feature 1                                       #                                             
O58997    176 ---rdsgsviglILAIILAPLAATlIQLAISRSREYLADETGARISgkpHALASALMKIEeavryrplrrgNPATA---H 249 Pyrococcus horikos...
KGM38640  174 e-egggagfiglIIMSIIAPMAAMiVQMAISRSREYLADATGARFAghpEGLAKALEKLGayskr-lpmdaNPSTA---H 248 Spirochaeta sp. JC202
CCU78116  172 ---nngagallqLVAIIFAPLAAIlIKMAISRSREYIADETGGKISgnpEGLASALEKMErysqgkeqmqiNEAAA---H 245 Halanaerobium sacc...
KFA92027  198 d-edglghalgnLGVLLVAPIAATlLQLAVSRSREYGADATGAELCgdpDALASALMKLErgael-mpydrAPATS---H 272 Cystobacter violac...
AGQ19686  168 -----nghpaiiLIAFIAAPIASLiIRMAISRTREYGADKTGSLISgnpLALASALEKIEmyskn--pldvNPAVSqlfI 240 Candidatus Actinom...
ADV82309  173 dsrdrngggigaLFMLILAPIAATlIQLWVSRTREYEADASGAAMTgnpYALARALQKIGaasar-vptfaSANTAh--M 249 Terriglobus saanen...
KKR18819  173 d-eedggnivgtLVLAIVAPIAAMlVQMAISRSREFHADATGASFAkdtQGLSSALEKLEvaskripmrhaNPSTA---H 248 candidate division...
ANM31806  176 --dgegahplalLGMALIAPIAAGiVQMSVSRSREYAADATGAEIAgspYGLASALEKLGrysqr-vptraTAATS---H 249 Acidobacteria bact...
ABS26972  193 s-ddergnvfaaLAWALLAPIIALiVQLAVSRSREFGADASGAELTgdpDALAEALLALErgnevrpyaygGPATAh-lF 270 Anaeromyxobacter s...
EKD65672  172 ----rggagafgLLIAILVPIAASiIQLAISRQREYGADETGARLIgngEPLARALIAIHdstrr-aplatNPAYSs-lY 245 uncultured bacterium
Feature 1                       #             
O58997    250 MFIINPFRGIDFAELFSTHPPTEKRIERLRKI 281 Pyrococcus horikoshii OT3
KGM38640  249 MFIVNPLSGKRMMSLFSTHPPLEERIARLRGT 280 Spirochaeta sp. JC202
CCU78116  246 MFILNPLSREGMAKLFSSHPPTAERIKRLRQT 277 Halanaerobium saccharolyticum subsp. saccharolyticum DSM 6643
KFA92027  273 LFIVNPLSGGAIMGLFSTHPPIPERVRRLREM 304 Cystobacter violaceus Cb vi76
AGQ19686  241 SNPLKSFSGSGLGKLFSTHPPTKERVRRLREG 272 Candidatus Actinomarina minuta
ADV82309  250 FINAPRISGADFASLFSTHPPMAKRIERLIGR 281 Terriglobus saanensis SP1PR4
KKR18819  249 MYISNPLRGRGMLSLFSTHPTTKARVEKLRAL 280 candidate division CPR2 bacterium GW2011_GWC2_39_35
ANM31806  250 MFIVMPLSLGQFRGLFATHPPIEERIRRLVGG 281 Acidobacteria bacterium Mor1
ABS26972  271 IVNPFRGAGGKMLQLFSTHPPIEARVERLRQM 302 Anaeromyxobacter sp. Fw109-5
EKD65672  246 ISNPLGGLGGGLTKLFSTHPPVEERVKRLRNI 277 uncultured bacterium

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap