1Z6U


Conserved Protein Domain Family
RING-HC_UHRF2

?
cd16770: RING-HC_UHRF2 
Click on image for an interactive view with Cn3D
RING finger, HC subclass, found in ubiquitin-like PHD and RING finger domain-containing protein 2 (UHRF2)
UHRF2, also known as Np95/ICBP90-like RING finger protein (NIRF), Np95-like RING finger protein, nuclear protein 97, nuclear zinc finger protein Np97, RING finger protein 107, or E3 ubiquitin-protein ligase UHRF2, was originally identified as a ubiquitin ligase acting as a small ubiquitin-like modifier (SUMO) E3 ligase that enhances zinc finger protein 131 (ZNF131) SUMOylation, but does not enhance ZNF131 ubiquitination. It also ubiquitinates PCNP, a PEST-containing nuclear protein. Moreover, UHRF2 functions as a nuclear protein involved in cell-cycle regulation and has been implicated in tumorigenesis. It interacts with cyclins, CDKs, p53, pRB, PCNA, HDAC1, DNMTs, G9a, methylated histone H3 lysine 9, and methylated DNA. It interacts with the cyclin E-CDK2 complex, ubiquitinates cyclins D1 and E1, induces G1 arrest, and is involved in the G1/S transition regulation. Furthermore, UHRF2 is a direct transcriptional target of the transcription factor E2F-1 in the induction of apoptosis. It recruits HDAC1 and binds to methyl-CpG. UHRF2 also participates in the maturation of Hepatitis B virus (HBV) through interacting with HBV core protein and promoting its degradation. UHRF2 contains an N-terminal ubiquitin-like domain (UBL), a tandem Tudor domain (TTD), a plant homeodomain (PHD) domain, a SET- and RING-associated (SRA) domain, and a C-terminal C3HC4-type RING-HC finger.
Statistics
?
PSSM-Id: 319684
View PSSM: cd16770
Aligned: 4 rows
Threshold Bit Score: 92.3946
Threshold Setting Gi: 66361347
Created: 23-Mar-2015
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
Zn binding siteRING-HC finger
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Structure:1Z6U; Homo sapiens UHRF2 binds two Zn2+ ions through RING-HC finger.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #  #           # #  #  #           #  #     
1Z6U_A        79 FMCVCCQELVYQPVTTECFHNVCKDCLQRSFKAQVFSCPACRHDLG 124 human
Q96PU4       731 FMCVCCQELVYQPVTTECFHNVCKDCLQRSFKAQVFSCPACRHDLG 776 human
XP_003643050 744 FMCVCCQELVYQPVTTECLHNVCKSCLQRSFRAEVFTCPACRYDLG 789 chicken
NP_001091384 774 FMCVCCQELVYQPVTTACLHNVCKSCLQRSFRAEVYTCPACRYDLG 819 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap