5A63


Conserved Protein Domain Family
PEN-2

?
pfam10251: PEN-2 (this model, PSSM-Id:313477 is obsolete and has been replaced by 402042)
Click on image for an interactive view with Cn3D
Presenilin enhancer-2 subunit of gamma secretase
This entry is a short 101 peptide protein which is the smallest subunit of the gamma-secretase aspartyl protease complex that catalyzes the intramembrane cleavage of a subset of type I transmembrane proteins. The other active constituents of the complex are presenilin (PS) nicastrin and anterior pharynx defective-1 (APH-1) protein. PEN-2 adopts a hairpin orientation in the membrane with its N- and C-terminal domains facing the luminal/extracellular space, and the C-terminal domain maintains PS stability within the complex.
Statistics
?
PSSM-Id: 313477
View PSSM: pfam10251
Aligned: 46 rows
Threshold Bit Score: 121.149
Threshold Setting Gi: 514680736
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5A63_D          7 SNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQ---SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRP 83  human
30_pfamImport   1 TEEASVDYARRFYKFGFALLPWLWAVNCFYFWPVLRHSRAF------PQIRNYVVRSAIGFSVFTALLSAWALTFSIGGE 74 
29_pfamImport   1 SEQESVDHARRFFKFGFLLLPWLWAVNCLYFWPVIRRPSSYYH----PDLRRYVVRSAIGFAVFAVILSSWALTFSIGGE 76 
8_pfamImport    1 TEDESLIYARRFYKFGFALLPWLWAVNCFYFWPVLFNSRSF------PRIRPYVVRSAVGFTVFTTVLCSWALTFAIGGE 74 
9_pfamImport    1 SEEESIKYARRFYKFGYALLPWLWAVNCFYFWPALRNSRSF------PRIRPYVIRSAVGFTAFSILLCSWALTFAIGGE 74 
Q54BR1         10 DDEKMINIAKKLWFIGFFFLPWVWLINILYFIPYRNSLN--------DKVKWYLKFSLIGFLGYSTIFMGWMGIYLVNRN 81  Dictyostelium ...
11_pfamImport   1 NDEKMRGIARKLWIAGFFFLPWVWMINILFFLPHRKVLS--------PAIIWYLKYSLIGFFVYTGIFMTWMGIYLVNRN 72 
Q5JN39         51 PLEEAEGHARRFFLWGFACLPFLWAINCCYFWPVLRSPATFPSSaafSRIRPYVVRSAIGFTIFSVVLLTWATTFIIGGE 130 Japanese rice
XP_009416941   44 SEEESAAYARSYFYWGFALLPLLWAVNCCYFWPVLRNSHPS------PHVRRYVMPSAIGFTIFTVLLGSWSLTFLIGGE 117 wild Malaysian...
EFA82289       10 NDEKMRGIARKLWIAGFFFLPWVWMINILFFLPHRKVLSP--------AIIWYLKYSLIGFFVYTGIFMTWMGIYLVNRN 81  Polysphondyliu...
5A63_D         84 -RWGALGDYLsFTIPLG 99  human
30_pfamImport  75 eLFGPVWDKL-VMYNVA 90 
29_pfamImport  77 rLFGHVWDKL-VMYNVA 92 
8_pfamImport   75 qLFGPVWDKL-VMYNVA 90 
9_pfamImport   75 rLFGPVWNEL-VMYNVA 90 
Q54BR1         82 -KWGAFGDDIsITIPFG 97  Dictyostelium discoideum
11_pfamImport  73 -KWGAFGDSIsITVPFG 88 
Q5JN39        131 rLFGPGWNDL-VMYNVA 146 Japanese rice
XP_009416941  118 qLFGPAWNDL-VMYNLA 133 wild Malaysian banana
EFA82289       82 -KWGAFGDSIsITVPFG 97  Polysphondylium pallidum PN500
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap