Conserved Protein Domain Family
DUF1986

?
pfam09342: DUF1986 
Domain of unknown function (DUF1986)
This domain is found in serine proteases and is predicted to contain disulphide bonds.
Statistics
?
PSSM-Id: 286432
Aligned: 3 rows
Threshold Bit Score: 201.622
Threshold Setting Gi: 74840375
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P98159 2041 WPWLADVYMNGDLWCIGVLIDKHWVMVHESCLSGIDLETHYVSVLLGGGKTKRSAhRSNHEQIRRVDCFEGVPKSNVLLL 2120 fruit fly
Q7QJ48 1091 WPWNTNIYLDGVMICSGLIIDASWIIVSGSCTRLVNLRHQYLAVVAGGAKSYLHI-EGPYEQVVRVDCYHYIPEAETVML 1169 Anopheles gambiae s...
Q8WSJ2 1523 CPWIAKVYVEGNYRCTGVLVDLSWVLVSHACLWDTSL-HSYISVVLGSHKTLKSV-KGPYEQIYKVDARKDLYRSKISLL 1600 domestic silkworm
P98159 2121 HLERPVRFTHHVLPTFLPDssHQNQSHArQCISVLHDD 2158 fruit fly
Q7QJ48 1170 HLATKLSFSRHVLPTFVPE--NENLTDS-ECLAVGQDK 1204 Anopheles gambiae str. PEST
Q8WSJ2 1601 HLKSPATYSNMVKPMIVAStrNHLEKNN-KCVTVGQFD 1637 domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap